StarFunc result for job id P84095

User Input

>input (191 residues)
MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAG
QEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLR
AQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPT
PIKRGRSCILL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P84095	1.000	1.000	1.609E-40	191	1.000	1.000	P84095.pdb.gz	RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1
2	AFDB:Q803F2	0.976	0.976	9.126E-35	191	0.801	0.801	Q803F2.pdb.gz	Q803F2_DANRE Ras homolog family member Gb OS=Danio rerio OX=7955 GN=ARHG PE=1 SV=1
3	PDB:6ukaA	0.912	0.983	1.720E-33	177	0.921	0.994	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
4	AFDB:A0A286QZ36	0.959	0.954	2.933E-31	192	0.707	0.703	A0A286QZ36.pdb.gz	RAC1_STIJA Ras-related protein Rac1 OS=Stichopus japonicus OX=307972 GN=RAC1 PE=2 SV=1
5	AFDB:G5EBV3	0.985	0.965	3.775E-31	195	0.597	0.585	G5EBV3.pdb.gz	G5EBV3_CAEEL Rac-like GTPase OS=Caenorhabditis elegans OX=6239 GN=mig-2 PE=1 SV=1
6	AFDB:P40792	0.980	0.975	1.103E-30	192	0.681	0.677	P40792.pdb.gz	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
7	AFDB:Q24814	0.939	0.915	1.420E-30	196	0.649	0.633	Q24814.pdb.gz	RACA_ENTH1 Rho-related protein racA OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=RACA PE=1 SV=1
8	AFDB:A2BHI1	0.972	0.849	1.513E-30	219	0.707	0.616	A2BHI1.pdb.gz
9	AFDB:M0R5T4	0.977	0.972	2.209E-30	192	0.691	0.688	M0R5T4.pdb.gz	M0R5T4_RAT Rac family small GTPase 3 OS=Rattus norvegicus OX=10116 GN=Rac3 PE=4 SV=3
10	AFDB:Q7JWS8	0.959	0.939	2.209E-30	195	0.654	0.641	Q7JWS8.pdb.gz	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
11	AFDB:P34144	0.975	0.960	5.342E-30	194	0.691	0.680	P34144.pdb.gz	RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum OX=44689 GN=rac1A PE=1 SV=2
12	PDB:2wkpA	0.925	0.555	3.134E-28	320	0.660	0.394	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:6jikA	0.914	0.959	3.788E-26	182	0.518	0.544	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
14	PDB:1nf3A	0.918	0.904	9.759E-26	194	0.592	0.582	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
15	PDB:4mitC	0.902	0.951	1.256E-25	181	0.524	0.552	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
16	PDB:5c2kA	0.914	0.459	1.338E-25	382	0.529	0.264	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
17	PDB:6hxuA	0.919	0.964	1.617E-25	182	0.508	0.533	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
18	PDB:3a58F	0.909	0.959	5.533E-24	181	0.539	0.569	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
19	PDB:2atxA	0.898	0.921	7.350E-23	186	0.534	0.548	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
20	PDB:2j0vB	0.838	0.868	2.148E-22	184	0.534	0.554	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P84095	1.23e-143	399	191	1.000	1.000	RHOG_HUMAN Rho-related GTP-binding protein RhoG OS=Homo sapiens OX=9606 GN=RHOG PE=1 SV=1
2	P84096	1.23e-143	399	191	1.000	1.000	RHOG_MOUSE Rho-related GTP-binding protein RhoG OS=Mus musculus OX=10090 GN=Rhog PE=1 SV=1
3	Q803F2	2.59e-117	332	191	0.801	0.801	Q803F2_DANRE Ras homolog family member Gb OS=Danio rerio OX=7955 GN=ARHG PE=1 SV=1
4	P62998	3.62e-99	286	192	0.723	0.719	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
5	P63000	3.62e-99	286	192	0.723	0.719	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
6	P63001	3.62e-99	286	192	0.723	0.719	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
7	Q6LC82	3.62e-99	286	192	0.723	0.719	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
8	Q6RUV5	3.62e-99	286	192	0.723	0.719	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1
9	A9JRY8	5.98e-98	283	192	0.707	0.703	A9JRY8_DANRE Rac family small GTPase 3b OS=Danio rerio OX=7955 GN=rac3b PE=1 SV=1
10	Q6IQN5	2.33e-97	282	192	0.707	0.703	Q6IQN5_DANRE Rac family small GTPase 2 OS=Danio rerio OX=7955 GN=zgc:86686 PE=1 SV=1
11	Q7ZSZ9	6.11e-97	281	192	0.723	0.719	Q7ZSZ9_DANRE Rac family small GTPase 1a OS=Danio rerio OX=7955 GN=rac1 PE=1 SV=1
12	P15153	1.02e-96	280	192	0.717	0.714	RAC2_HUMAN Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens OX=9606 GN=RAC2 PE=1 SV=1
13	P34145	1.70e-96	280	194	0.686	0.675	RAC1B_DICDI Rho-related protein rac1B OS=Dictyostelium discoideum OX=44689 GN=rac1B PE=1 SV=2
14	Q05144	7.76e-96	278	192	0.717	0.714	RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus OX=10090 GN=Rac2 PE=1 SV=1
15	Q5U1Y2	7.76e-96	278	192	0.717	0.714	Q5U1Y2_RAT Ras-related C3 botulinum toxin substrate 2 (Rho family, small GTP binding protein Rac2) OS=Rattus norvegicus OX=10116 GN=Rac2 PE=2 SV=1
16	P34144	9.07e-96	278	194	0.681	0.670	RAC1A_DICDI Rho-related protein rac1A OS=Dictyostelium discoideum OX=44689 GN=rac1A PE=1 SV=2
17	A0A286QZ36	2.89e-95	276	192	0.707	0.703	RAC1_STIJA Ras-related protein Rac1 OS=Stichopus japonicus OX=307972 GN=RAC1 PE=2 SV=1
18	Q03206	6.78e-95	275	191	0.665	0.665	RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans OX=6239 GN=ced-10 PE=1 SV=2
19	O93466	1.49e-93	272	192	0.670	0.667	O93466_CHICK GTPase cRac1B OS=Gallus gallus OX=9031 GN=cRac1B PE=1 SV=1
20	A0A0G2JUG6	2.41e-93	271	192	0.675	0.672	A0A0G2JUG6_RAT Rac family small GTPase 3 OS=Rattus norvegicus OX=10116 GN=Rac3 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	2.3e-05	35.5	ADP-ribosylation factor family
2	PF04670 Gtr1_RagA	94	13.8	Gtr1/RagA G protein conserved region
3	PF00071 Ras	4.4e-54	193.9	Ras family
4	PF08477 Roc	3.5e-18	77.4	Ras of Complex, Roc, domain of DAPkinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9707.XP_004391773.1

Rank	PPI partner	STRING score	Description
1	9707.XP_004405322.1	0.996	Engulfment and cell motility protein 2 isoform 1
2	9707.XP_004414479.1	0.992	Engulfment and cell motility protein 1 isoform 1
3	9707.XP_004404410.1	0.987	Belongs to the DOCK family
4	9707.XP_004405047.1	0.967	Rho guanine nucleotide exchange factor 26
5	9707.XP_004393449.1	0.949	Engulfment and cell motility protein 3 isoform 1
6	9707.XP_004391977.1	0.892	Kalirin isoform 1
7	9707.XP_004413373.1	0.851	Integrin-linked protein kinase isoform 1
8	9707.XP_004402228.1	0.843	Rho guanine nucleotide exchange factor 40
9	9707.XP_004404539.1	0.838	Rho GDP-dissociation inhibitor 1
10	9707.XP_004394982.1	0.828	Intersectin-2
11	9707.XP_004406327.1	0.828	Intersectin-1 isoform 1
12	9707.XP_004403135.1	0.826	Rho GDP-dissociation inhibitor 3
13	9707.XP_004405619.1	0.825	Guanine nucleotide exchange factor VAV3 isoform X1
14	9707.XP_004411445.1	0.824	Guanine nucleotide exchange factor VAV2 isoform X1
15	9707.XP_004403501.1	0.817	Rho guanine nucleotide exchange factor 28 isoform X2
16	9707.XP_004396735.1	0.810	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
17	9707.XP_004407289.1	0.808	LOW QUALITY PROTEIN: rho GTPase-activating protein 27
18	9707.XP_004411694.1	0.807	Pleckstrin homology domain-containing family G member 4B
19	9707.XP_004405847.1	0.804	Rho GTPase-activating protein 15 isoform X1
20	9707.XP_004401330.1	0.800	Belongs to the NGF-beta family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003924	0.992	GTPase activity
GO:1901363	0.856	heterocyclic compound binding
GO:0097159	0.853	organic cyclic compound binding
GO:0017076	0.839	purine nucleotide binding
GO:0043168	0.829	anion binding
GO:0032555	0.825	purine ribonucleotide binding
GO:0032561	0.545	guanyl ribonucleotide binding
GO:0005525	0.530	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050896	0.963	response to stimulus
GO:0044087	0.784	regulation of cellular component biogenesis
GO:0031344	0.738	regulation of cell projection organization
GO:0051716	0.727	cellular response to stimulus
GO:0071840	0.724	cellular component organization or biogenesis
GO:0048518	0.722	positive regulation of biological process
GO:0016043	0.690	cellular component organization
GO:0023052	0.629	signaling
GO:0007154	0.615	cell communication
GO:0007165	0.611	signal transduction
GO:0048522	0.605	positive regulation of cellular process
GO:0060491	0.537	regulation of cell projection assembly
GO:0032502	0.527	developmental process
GO:0048856	0.511	anatomical structure development
GO:0120035	0.506	regulation of plasma membrane bounded cell projection organization
GO:0019222	0.458	regulation of metabolic process
GO:0032501	0.399	multicellular organismal process
GO:0048519	0.375	negative regulation of biological process
GO:0030029	0.358	actin filament-based process
GO:0035556	0.330	intracellular signal transduction
GO:0042221	0.326	response to chemical
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0071944	0.995	cell periphery
GO:0005886	0.990	plasma membrane
GO:0012505	0.988	endomembrane system
GO:0043229	0.983	intracellular organelle
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0005829	0.952	cytosol
GO:0031982	0.922	vesicle
GO:0030054	0.847	cell junction
GO:0042995	0.481	cell projection
GO:0120025	0.464	plasma membrane bounded cell projection
GO:0005576	0.448	extracellular region
GO:0031090	0.405	organelle membrane
GO:0031410	0.386	cytoplasmic vesicle
GO:0005615	0.377	extracellular space
GO:0098588	0.376	bounding membrane of organelle
GO:0030659	0.368	cytoplasmic vesicle membrane
GO:0070062	0.342	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.992	GTP + H2O = GDP + H(+) + phosphate

[back to server]