StarFunc result for job id P84550

User Input

>input (965 residues)
MALLCGLGQVTLRIWVSLPSQSENGIGFLAARAFLRSGGMEALTTQLGPGREGSSSPNSK
QELQPYSGSSALKPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNEIHNRR
VALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGEHKPPKLPENFA
FDVVHECAWGSRGSFIPARYNSSRAKCIKCGYCSMYFSPNKFIFHSHRTPDAKYTQPDAA
NFNSWRRHLKLSDKSATDELSHAWEDVKAMFNGGTRKRTFSLQGGGGGGANGGSGGQGKG
GAGGGGGGGPGCGAEMAPGPPPHKSLRCGEDEAAGPPGPPPPHPQRGLGLATGASGPAGP
GGPGGGAGVRSYPVIPVPSKGFGLLQKLPPPLFPHPYGFPTAFGLCPKKDDPVLGAGEPK
GGPGTGSGGGGAGTGGGAGGPGASHLPPGAGAGPGGGAMFWGHQPSGAAKDAAAVAAAAA
AATVYPTFPMFWPAAGSLPVPSYPAAQSQAKAVAAAVAAAAAAAAAAAGSGAPEPLDGAE
PAKESGLGAEERCPSALSRGPLDEDGTDEALPPPLAPLPPPPPPPARKGSYVSAFRPVVK
DTESIAKLYGSAREAYGAGPARGPGPGAGSGGYVSPDFLSEGSSSYNSASPDVDTADEPE
VDVESNRFPDDEDAQEETEPSAPSAGGGPDGEQPTGPPSATSSGADGPANSPDGGSPRPR
RRLGPPPAGRPAFGDLAAEDLVRRPERSPPSGGGGYELREPCGPLGGPAPAKVFAPERDE
HVKSAAVALGPAASYVCTPEAHEPDKEDNHSPADDLETRKSYPDQRSISQPSPANTDRGE
DGLTLDVTGTHLVEKDIENLAREELQKLLLEQMELRKKLEREFQSLKDNFQDQMKRELAY
REEMVQQLQIVRDTLCNELDQERKARYAIQQKLKEAHDALHHFSCKMLTPRHCTGNCSFK
PPLLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P84550	1.000	1.000	0.000	965	1.000	1.000	P84550.pdb.gz	SKOR1_HUMAN SKI family transcriptional corepressor 1 OS=Homo sapiens OX=9606 GN=SKOR1 PE=1 SV=1
2	AFDB:Q2VWA4	0.250	0.242	3.921E-49	1001	0.415	0.400	Q2VWA4.pdb.gz	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
3	AFDB:D1YSG4	0.221	0.277	3.841E-38	770	0.246	0.308	D1YSG4.pdb.gz	D1YSG4_DROME CORL OS=Drosophila melanogaster OX=7227 GN=fuss PE=2 SV=1
4	AFDB:A0A0G2K9F7	0.087	0.081	1.124E-2	1180	0.141	0.115	A0A0G2K9F7.pdb.gz	A0A0G2K9F7_RAT Zinc finger, MYND-type containing 8 OS=Rattus norvegicus OX=10116 GN=Zmynd8 PE=1 SV=2
5	AFDB:P14907	0.047	0.045	3.227E-2	823	0.134	0.157	P14907.pdb.gz	NSP1_YEAST Nucleoporin NSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSP1 PE=1 SV=1
6	AFDB:E7F1U4	0.064	0.044	7.328E-2	1507	0.115	0.074	E7F1U4.pdb.gz	E7F1U4_DANRE Ras/Rap GTPase-activating protein SynGAP1b OS=Danio rerio OX=7955 GN=si:dkey-246f6.1 PE=1 SV=4
7	AFDB:Q9DF49	0.077	0.071	9.822E-2	1074	0.138	0.124	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
8	AFDB:Q8SXD4	0.053	0.048	1.171E-1	1122	0.117	0.101	Q8SXD4.pdb.gz	MIDN_DROME Midnolin homolog OS=Drosophila melanogaster OX=7227 GN=stx PE=1 SV=1
9	AFDB:Q9R0G7	0.062	0.052	1.871E-1	1215	0.136	0.108	Q9R0G7.pdb.gz	ZEB2_MOUSE Zinc finger E-box-binding homeobox 2 OS=Mus musculus OX=10090 GN=Zeb2 PE=1 SV=2
10	AFDB:P39769	0.094	0.061	2.365E-1	1589	0.107	0.065	P39769.pdb.gz	PHP_DROME Polyhomeotic-proximal chromatin protein OS=Drosophila melanogaster OX=7227 GN=ph-p PE=1 SV=2
11	PDB:4ob3B	0.038	0.105	4.965E-1	229	0.027	0.114	4ob3B.pdb.gz	The active site sulfenic acid ligand in nitrile hydratases can function as a nucleophile.
12	PDB:6fyxm	0.052	0.237	2.277	147	0.016	0.102	6fyxm.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
13	PDB:7by6B	0.047	0.071	2.715	606	0.012	0.020	7by6B.pdb.gz	Structural basis of malaria parasite phenylalanine tRNA-synthetase inhibition by bicyclic azetidines.
14	PDB:4zzlA	0.044	0.159	2.879	146	0.011	0.075	4zzlA.pdb.gz
15	PDB:4wydA	0.032	0.054	3.858	430	0.020	0.044	4wydA.pdb.gz	Fragment-Based Exploration of Binding Site Flexibility in Mycobacterium tuberculosis BioA.
16	PDB:7dblA	0.031	0.061	4.338	422	0.007	0.017	7dblA.pdb.gz	Structural basis for substrate specificity of the peroxisomal acyl-CoA hydrolase MpaH' involved in mycophenolic acid biosynthesis.
17	PDB:2mxcA	0.040	0.139	4.600	172	0.016	0.087	2mxcA.pdb.gz
18	PDB:7f5sLE	0.041	0.133	4.600	223	0.011	0.049	7f5sLE.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
19	PDB:6v4xG	0.038	0.224	5.814	77	0.006	0.078	6v4xG.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
20	PDB:2qpzA	0.028	0.230	6.537	103	0.003	0.029	2qpzA.pdb.gz	Determining Rieske cluster reduction potentials.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P84550	0.0	1931	965	1.000	1.000	SKOR1_HUMAN SKI family transcriptional corepressor 1 OS=Homo sapiens OX=9606 GN=SKOR1 PE=1 SV=1
2	Q8BX46	0.0	1425	964	0.913	0.914	SKOR1_MOUSE SKI family transcriptional corepressor 1 OS=Mus musculus OX=10090 GN=Skor1 PE=1 SV=2
3	A7M7C7	1.28e-130	421	1008	0.199	0.190	SKOR2_MOUSE SKI family transcriptional corepressor 2 OS=Mus musculus OX=10090 GN=Skor2 PE=1 SV=1
4	Q2VWA4	2.15e-130	421	1015	0.199	0.189	SKOR2_HUMAN SKI family transcriptional corepressor 2 OS=Homo sapiens OX=9606 GN=SKOR2 PE=1 SV=3
5	D1YSG4	2.45e-113	368	770	0.167	0.209	D1YSG4_DROME CORL OS=Drosophila melanogaster OX=7227 GN=fuss PE=2 SV=1
6	P17863	2.62e-31	130	437	0.079	0.174	SKI_AVIES Transforming protein Ski OS=Avian erythroblastosis virus (strain Sloan-Kettering) OX=11862 GN=V-SKI PE=1 SV=1
7	P12755	1.10e-30	132	728	0.082	0.109	SKI_HUMAN Ski oncogene OS=Homo sapiens OX=9606 GN=SKI PE=1 SV=1
8	Q60698	1.34e-30	131	725	0.081	0.108	SKI_MOUSE Ski oncogene OS=Mus musculus OX=10090 GN=Ski PE=1 SV=2
9	A0A0G2K628	2.23e-30	131	727	0.081	0.107	A0A0G2K628_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=1 SV=2
10	A0A8I5ZYW7	2.38e-30	130	686	0.081	0.114	A0A8I5ZYW7_RAT Ski oncogene OS=Rattus norvegicus OX=10116 GN=Ski PE=3 SV=1
11	P49140	3.78e-30	130	750	0.078	0.100	SKI_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=1 SV=1
12	E1BSJ7	3.85e-30	130	750	0.078	0.100	E1BSJ7_CHICK Ski oncogene OS=Gallus gallus OX=9031 GN=SKI PE=3 SV=2
13	Q1ECW8	4.50e-30	130	727	0.077	0.102	Q1ECW8_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=id:ibd1250 PE=2 SV=1
14	F1P0N0	2.00e-29	127	690	0.080	0.112	F1P0N0_CHICK SKI like proto-onco OS=Gallus gallus OX=9031 GN=SKIL PE=3 SV=2
15	Q05951	2.22e-29	127	690	0.080	0.112	Q05951_CHICK C-sno protein OS=Gallus gallus OX=9031 GN=c-sno PE=2 SV=1
16	Q9YI02	1.43e-28	125	695	0.077	0.106	Q9YI02_DANRE Ski oncogene OS=Danio rerio OX=7955 GN=skiB PE=2 SV=1
17	Q60979	1.65e-25	115	674	0.076	0.108	Q60979_MOUSE SnoN protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=1
18	D3ZWL1	2.17e-25	115	677	0.076	0.108	D3ZWL1_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1
19	Q60665	2.78e-25	114	675	0.076	0.108	SKIL_MOUSE Ski-like protein OS=Mus musculus OX=10090 GN=Skil PE=1 SV=2
20	A0A8I6A1B8	3.05e-25	113	551	0.076	0.132	A0A8I6A1B8_RAT SKI-like proto-oncogene OS=Rattus norvegicus OX=10116 GN=Skil PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08782 c-SKI_SMAD_bind	8.5e-27	104.5	c-SKI Smad4 binding domain
2	PF05300 MIC19_MIC25	10	17.7	MICOS complex subunit MIC19/MIC25
3	PF02437 Ski_Sno	9.4e-36	133.2	SKI/SNO/DAC family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015882

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000018047	0.749	Ladybird homeobox 1
2	61853.ENSNLEP00000013761	0.683	BTB (POZ) domain containing 9
3	61853.ENSNLEP00000015776	0.663	Mothers against decapentaplegic homolog
4	61853.ENSNLEP00000001198	0.613	TOX high mobility group box family member 3
5	61853.ENSNLEP00000013000	0.601	BRCA1-associated ATM activator 1
6	61853.ENSNLEP00000003912	0.595	Transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
7	61853.ENSNLEP00000015873	0.559	Belongs to the protein kinase superfamily.
8	61853.ENSNLEP00000024018	0.552	Armadillo repeat containing 1
9	61853.ENSNLEP00000015673	0.541	Glycoprotein hormones, alpha polypeptide
10	61853.ENSNLEP00000021443	0.540	Protein tyrosine phosphatase, receptor type, D
11	61853.ENSNLEP00000009271	0.529	Uncharacterized protein
12	61853.ENSNLEP00000012146	0.524	Meis homeobox 1
13	61853.ENSNLEP00000016348	0.520	Protein tyrosine phosphatase, receptor type, S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046332	1.000	SMAD binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.976	negative regulation of biological process
GO:0048523	0.969	negative regulation of cellular process
GO:0023051	0.751	regulation of signaling
GO:0010646	0.751	regulation of cell communication
GO:0048583	0.744	regulation of response to stimulus
GO:0030510	0.677	regulation of BMP signaling pathway
GO:0090288	0.583	negative regulation of cellular response to growth factor stimulus
GO:0019222	0.558	regulation of metabolic process
GO:0090101	0.543	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0031323	0.425	regulation of cellular metabolic process
GO:0009889	0.422	regulation of biosynthetic process
GO:0019219	0.419	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.412	cellular process
GO:0010468	0.407	regulation of gene expression
GO:1903506	0.405	regulation of nucleic acid-templated transcription
GO:0006355	0.404	regulation of DNA-templated transcription
GO:0032501	0.380	multicellular organismal process
GO:0032502	0.339	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.983	protein-containing complex
GO:0005737	0.874	cytoplasm
GO:0005667	0.490	transcription regulator complex
GO:0120025	0.462	plasma membrane bounded cell projection
GO:0043005	0.447	neuron projection
GO:0036477	0.427	somatodendritic compartment
GO:0043025	0.420	neuronal cell body
GO:0031981	0.349	nuclear lumen
GO:0016020	0.334	membrane
GO:0030425	0.308	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]