StarFunc result for job id P85298

User Input

>input (464 residues)
MAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKY
TLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSS
HLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHL
KYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELI
PPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILK
TFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLRYLMGFLHAVS
RESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGE
HGLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P85298	1.000	1.000	5.741E-78	464	1.000	1.000	P85298.pdb.gz	RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8 PE=1 SV=1
2	AFDB:B1AHC3	0.698	0.587	4.892E-67	564	0.931	0.766	B1AHC3.pdb.gz	B1AHC3_HUMAN PRR5-ARHGAP8 readthrough OS=Homo sapiens OX=9606 GN=PRR5-ARHGAP8 PE=1 SV=1
3	AFDB:D4A6C5	0.772	0.815	7.760E-44	439	0.470	0.497	D4A6C5.pdb.gz	D4A6C5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
4	AFDB:Q23130	0.759	0.792	6.074E-34	444	0.323	0.338	Q23130.pdb.gz	Q23130_CAEEL Rho GTPase-activating protein 68F OS=Caenorhabditis elegans OX=6239 GN=rga-1 PE=1 SV=1
5	AFDB:Q9VTU3	0.714	0.697	2.106E-33	476	0.293	0.286	Q9VTU3.pdb.gz	RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster OX=7227 GN=RhoGAP68F PE=1 SV=1
6	PDB:6r3vA	0.418	0.966	1.324E-20	198	0.228	0.535	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
7	AFDB:Q53QZ3	0.404	0.395	3.831E-16	475	0.159	0.156	Q53QZ3.pdb.gz	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
8	AFDB:Q1RLN5	0.403	0.236	1.144E-15	799	0.142	0.083	Q1RLN5.pdb.gz	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
9	AFDB:Q9P3B1	0.363	0.446	1.396E-15	374	0.190	0.235	Q9P3B1.pdb.gz	YIL2_SCHPO Putative Rho GTPase-activating protein C1565.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1565.02c PE=1 SV=1
10	AFDB:Q9VDS5	0.392	0.248	1.978E-15	740	0.177	0.111	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
11	AFDB:Q6ZT62	0.382	0.264	2.536E-15	677	0.181	0.124	Q6ZT62.pdb.gz	BGIN_HUMAN Bargin OS=Homo sapiens OX=9606 GN=BARGIN PE=1 SV=2
12	PDB:3cxlA	0.386	0.443	1.468E-10	402	0.108	0.124	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:5c2kA	0.343	0.411	3.594E-10	382	0.134	0.162	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
14	PDB:1xa6A	0.395	0.457	7.578E-10	399	0.110	0.128	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
15	PDB:5jcpA	0.343	0.437	8.981E-8	361	0.080	0.102	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:7wvtA	0.256	0.322	6.803E-6	364	0.095	0.121	7wvtA.pdb.gz	Structural basis of ligand recognition and transport by Sfh2, a yeast phosphatidylinositol transfer protein of the Sec14 superfamily.
17	PDB:7mp5A	0.295	0.089	4.077E-5	1629	0.129	0.037	7mp5A.pdb.gz
18	PDB:6f0eA	0.231	0.340	6.704E-5	300	0.062	0.097	6f0eA.pdb.gz	Target Identification and Mechanism of Action of Picolinamide and Benzamide Chemotypes with Antifungal Properties.
19	PDB:7pgrN	0.291	0.061	8.598E-5	2423	0.127	0.024	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
20	PDB:7r04A	0.275	0.059	4.665E-4	2326	0.112	0.022	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AHC3	0.0	841	564	0.933	0.768	B1AHC3_HUMAN PRR5-ARHGAP8 readthrough OS=Homo sapiens OX=9606 GN=PRR5-ARHGAP8 PE=1 SV=1
2	P85298	0.0	957	464	1.000	1.000	RHG08_HUMAN Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8 PE=1 SV=1
3	Q8IZM6	0.0	833	433	0.931	0.998	Q8IZM6_HUMAN BCH domain-containing Cdc42GAP-like protein OS=Homo sapiens OX=9606 GN=BPGAP1 PE=2 SV=1
4	Q07960	2.10e-143	419	439	0.463	0.490	RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1
5	D4A6C5	1.08e-141	415	439	0.461	0.487	D4A6C5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
6	Q5FWK3	3.93e-141	413	439	0.457	0.483	RHG01_MOUSE Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arhgap1 PE=1 SV=1
7	A0A0G2JYR5	1.41e-139	412	512	0.461	0.418	A0A0G2JYR5_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
8	A0A8I6A7T6	2.73e-112	338	410	0.418	0.473	A0A8I6A7T6_RAT Rho GTPase activating protein 1 OS=Rattus norvegicus OX=10116 GN=Arhgap1 PE=1 SV=1
9	Q23130	7.97e-81	259	444	0.328	0.342	Q23130_CAEEL Rho GTPase-activating protein 68F OS=Caenorhabditis elegans OX=6239 GN=rga-1 PE=1 SV=1
10	Q9VTU3	2.25e-67	225	476	0.291	0.284	RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster OX=7227 GN=RhoGAP68F PE=1 SV=1
11	Q58AA5	5.87e-36	135	245	0.177	0.335	Q58AA5_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rga-1 PE=1 SV=1
12	Q8C4V1	1.07e-24	109	747	0.127	0.079	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
13	Q7Z5H3	2.38e-23	105	698	0.131	0.087	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
14	Q8N264	3.42e-23	105	748	0.125	0.078	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
15	O94988	4.25e-23	105	1023	0.140	0.064	FA13A_HUMAN Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2
16	Q6REY9	1.20e-21	100	1182	0.138	0.054	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
17	Q9VDS5	1.97e-21	99.8	740	0.153	0.096	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
18	Q53QZ3	4.41e-21	97.8	475	0.123	0.120	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
19	Q9P2F6	6.48e-21	98.6	1191	0.136	0.053	RHG20_HUMAN Rho GTPase-activating protein 20 OS=Homo sapiens OX=9606 GN=ARHGAP20 PE=1 SV=2
20	D3ZFJ3	2.23e-20	96.7	689	0.149	0.100	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00650 CRAL_TRIO	0.00019	32.7	CRAL/TRIO domain
2	PF13716 CRAL_TRIO_2	3.7e-32	122.9	Divergent CRAL/TRIO domain
3	PF00620 RhoGAP	2.3e-36	136.3	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384848	0.913	Proline-rich protein 5
2	9606.ENSP00000368144	0.639	Proline-rich protein 5-like
3	9606.ENSP00000365745	0.615	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
4	9606.ENSP00000296782	0.610	Rapamycin-insensitive companion of mTOR
5	9606.ENSP00000463375	0.610	Transmembrane protein 200C
6	9606.ENSP00000385467	0.557	Uncharacterized protein C22orf46
7	9606.ENSP00000294244	0.556	SPIN1-docking protein
8	9606.ENSP00000374424	0.525	Rho GTPase activating protein 8
9	9606.ENSP00000383118	0.500	Cell division control protein 42 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048522	0.988	positive regulation of cellular process
GO:0009966	0.957	regulation of signal transduction
GO:1902531	0.914	regulation of intracellular signal transduction
GO:0051056	0.848	regulation of small GTPase mediated signal transduction
GO:0009987	0.827	cellular process
GO:1902533	0.787	positive regulation of intracellular signal transduction
GO:0070372	0.466	regulation of ERK1 and ERK2 cascade
GO:0043410	0.436	positive regulation of MAPK cascade
GO:0050896	0.331	response to stimulus
GO:0070374	0.317	positive regulation of ERK1 and ERK2 cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.753	organelle
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:0016020	0.471	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]