StarFunc result for job id P85299

User Input

>input (388 residues)
MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLP
DQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWD
FFFSDVLPMLQAIFYPVQGKEPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQM
LLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRS
GDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPG
QGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSDS
EGIFIDFGRGRGSGMSDLEGSGGRQSVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P85299	1.000	1.000	1.894E-49	388	1.000	1.000	P85299.pdb.gz	PRR5_HUMAN Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5 PE=1 SV=1
2	AFDB:Q812A5	0.605	0.607	1.943E-42	387	0.892	0.894	Q812A5.pdb.gz	PRR5_MOUSE Proline-rich protein 5 OS=Mus musculus OX=10090 GN=Prr5 PE=1 SV=2
3	AFDB:A2AVJ5	0.495	0.518	6.365E-19	370	0.343	0.359	A2AVJ5.pdb.gz	PRR5L_MOUSE Proline-rich protein 5-like OS=Mus musculus OX=10090 GN=Prr5l PE=1 SV=1
4	AFDB:Q9S9P0	0.106	0.058	3.958E-2	990	0.155	0.061	Q9S9P0.pdb.gz	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
5	AFDB:Q304E5	0.159	0.095	7.009E-2	771	0.111	0.056	Q304E5.pdb.gz	Q304E5_CAEEL Guanyl-specific ribonuclease pgl-1 OS=Caenorhabditis elegans OX=6239 GN=pgl-1 PE=1 SV=1
6	AFDB:Q57ZA6	0.106	0.043	7.351E-2	1572	0.134	0.033	Q57ZA6.pdb.gz	Q57ZA6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.1020 PE=4 SV=1
7	AFDB:Q9BQG0	0.176	0.070	7.351E-2	1328	0.137	0.040	Q9BQG0.pdb.gz	MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2
8	PDB:6v9iC	0.300	0.170	7.643E-2	730	0.077	0.041	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
9	AFDB:F1LQJ2	0.149	0.057	1.241E-1	1578	0.175	0.043	F1LQJ2.pdb.gz	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
10	AFDB:Q9Z1T1	0.138	0.069	1.365E-1	1105	0.134	0.047	Q9Z1T1.pdb.gz	AP3B1_MOUSE AP-3 complex subunit beta-1 OS=Mus musculus OX=10090 GN=Ap3b1 PE=1 SV=2
11	PDB:4a0kA	0.315	0.181	1.420E-1	719	0.088	0.047	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
12	AFDB:Q7SYD5	0.101	0.046	1.502E-1	1254	0.149	0.046	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
13	PDB:5wlcST	0.122	0.093	2.078E-1	599	0.064	0.042	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
14	PDB:7wtww	0.106	0.120	2.179E-1	332	0.095	0.111	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:1ldjA	0.347	0.195	2.765E-1	725	0.077	0.041	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
16	PDB:6ww7B	0.095	0.117	3.859E-1	281	0.036	0.050	6ww7B.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
17	PDB:7d5sRN	0.151	0.107	4.896E-1	607	0.077	0.049	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:5l4kP	0.109	0.096	5.135E-1	456	0.059	0.050	5l4kP.pdb.gz
19	PDB:5tbkA	0.165	0.157	5.648E-1	417	0.046	0.043	5tbkA.pdb.gz
20	PDB:4hm9A	0.139	0.118	5.924E-1	511	0.064	0.049	4hm9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P85299	0.0	793	388	1.000	1.000	PRR5_HUMAN Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5 PE=1 SV=1
2	Q812A5	0.0	696	387	0.892	0.894	PRR5_MOUSE Proline-rich protein 5 OS=Mus musculus OX=10090 GN=Prr5 PE=1 SV=2
3	Q6MZQ0	7.76e-74	236	368	0.335	0.353	PRR5L_HUMAN Proline-rich protein 5-like OS=Homo sapiens OX=9606 GN=PRR5L PE=1 SV=2
4	A2AVJ5	5.67e-72	231	370	0.327	0.343	PRR5L_MOUSE Proline-rich protein 5-like OS=Mus musculus OX=10090 GN=Prr5l PE=1 SV=1
5	B1AHC3	3.58e-66	221	564	0.276	0.190	B1AHC3_HUMAN PRR5-ARHGAP8 readthrough OS=Homo sapiens OX=9606 GN=PRR5-ARHGAP8 PE=1 SV=1
6	O74547	4.70e-04	44.3	422	0.121	0.111	BIT61_SCHPO Target of rapamycin complex 2 subunit bit61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bit61 PE=1 SV=1
7	I7H727	1.0	33.9	556	0.137	0.095	TPS2_TOOSI Sesquiterpene synthase 2 OS=Toona sinensis OX=443222 GN=TPS2 PE=1 SV=1
8	Q38AL5	1.0	33.9	709	0.064	0.035	Q38AL5_TRYB2 Cullin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3170 PE=3 SV=1
9	Q04721	1.7	33.5	2471	0.049	0.008	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
10	O14208	2.2	32.7	302	0.034	0.043	YDT3_SCHPO Uncharacterized protein C6B12.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6B12.03c PE=4 SV=1
11	Q03350	2.6	32.7	1172	0.046	0.015	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
12	Q6PCN3	3.2	32.7	1308	0.085	0.025	TTBK1_MOUSE Tau-tubulin kinase 1 OS=Mus musculus OX=10090 GN=Ttbk1 PE=1 SV=3
13	F1D8R8	7.0	31.2	461	0.057	0.048	F1D8R8_HUMAN Steroidogenic factor 1 nuclear receptor OS=Homo sapiens OX=9606 GN=NR5A1 PE=2 SV=1
14	Q13285	7.0	31.2	461	0.057	0.048	STF1_HUMAN Steroidogenic factor 1 OS=Homo sapiens OX=9606 GN=NR5A1 PE=1 SV=2
15	Q21346	9.1	31.2	729	0.054	0.029	CUL6_CAEEL Cullin-6 OS=Caenorhabditis elegans OX=6239 GN=cul-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08539 HbrB	2.7e-12	58.5	HbrB-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000024962

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000044691	0.943	RPTOR independent companion of MTOR, complex 2
2	9598.ENSPTRP00000000280	0.599	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0016310	0.980	phosphorylation
GO:0019222	0.940	regulation of metabolic process
GO:0048522	0.939	positive regulation of cellular process
GO:0031323	0.919	regulation of cellular metabolic process
GO:0050896	0.913	response to stimulus
GO:0080090	0.902	regulation of primary metabolic process
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0051716	0.893	cellular response to stimulus
GO:0007154	0.892	cell communication
GO:0071704	0.881	organic substance metabolic process
GO:0044238	0.880	primary metabolic process
GO:0051171	0.869	regulation of nitrogen compound metabolic process
GO:0009966	0.856	regulation of signal transduction
GO:0007165	0.838	signal transduction
GO:0051246	0.830	regulation of protein metabolic process
GO:1902531	0.827	regulation of intracellular signal transduction
GO:0051174	0.792	regulation of phosphorus metabolic process
GO:0035556	0.751	intracellular signal transduction
GO:0031399	0.701	regulation of protein modification process
GO:0031325	0.665	positive regulation of cellular metabolic process
GO:0010604	0.625	positive regulation of macromolecule metabolic process
GO:0019220	0.618	regulation of phosphate metabolic process
GO:0001932	0.589	regulation of protein phosphorylation
GO:0043170	0.558	macromolecule metabolic process
GO:0006807	0.550	nitrogen compound metabolic process
GO:0051173	0.504	positive regulation of nitrogen compound metabolic process
GO:0006468	0.475	protein phosphorylation
GO:0048584	0.360	positive regulation of response to stimulus
GO:0051247	0.333	positive regulation of protein metabolic process
GO:0009967	0.306	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031932	0.997	TORC2 complex
GO:0043231	0.890	intracellular membrane-bounded organelle
GO:0005634	0.773	nucleus
GO:0070013	0.748	intracellular organelle lumen
GO:0031981	0.388	nuclear lumen
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]