StarFunc result for job id P86481

User Input

>input (221 residues)
MEEPRPSKRLRSMAPNQASGGPPPEPGCCVADPEGSVEADGPAQPAQPAKPIAYVKPFRR
QPPARPESPPPAERGRRRGGSRRPGRGRGRRAGPRGDAGQRQGAEGLMAPDVHIQLDHHG
EPGHQGEPEITETAAFSLSETGPPPGTVQEGPGPDVAQPELGFQEPPAAPGPQAVDWQPV
LTLYPCIGFRALGDSAVLQVIQTPQGTYVQGVPVFLTDIAY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P86478	0.285	0.285	1.204E-27	221	1.000	1.000	P86478.pdb.gz	PR20E_HUMAN Proline-rich protein 20E OS=Homo sapiens OX=9606 GN=PRR20E PE=1 SV=1
2	AFDB:P31367	0.101	0.051	1.501	610	0.190	0.069	P31367.pdb.gz	PO6F1_DANRE POU domain, class 6, transcription factor 1 OS=Danio rerio OX=7955 GN=pou6f1 PE=2 SV=1
3	PDB:4f881	0.076	0.045	3.388	430	0.023	0.012	4f881.pdb.gz
4	AFDB:P53882	0.098	0.053	6.070	636	0.113	0.039	P53882.pdb.gz	TDA7_YEAST Topoisomerase I damage affected protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TDA7 PE=1 SV=2
5	PDB:5cslA	0.051	0.010	6.353	2050	0.023	0.002	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
6	PDB:5mrvC	0.072	0.162	6.353	53	0.027	0.113	5mrvC.pdb.gz	Crystal structure and mechanism of human carboxypeptidase O: Insights into its specific activity for acidic residues.
7	PDB:3j7a4	0.093	0.205	7.306	76	0.027	0.079	3j7a4.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
8	PDB:6xk9Y	0.080	0.022	7.306	1106	0.045	0.009	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
9	PDB:1xhsA	0.065	0.122	7.834	113	0.032	0.062	1xhsA.pdb.gz
10	PDB:7nbuY	0.088	0.135	7.834	121	0.009	0.017	7nbuY.pdb.gz	Substrate recognition and cryo-EM structure of the ribosome-bound TAC toxin of Mycobacterium tuberculosis.
11	PDB:2lx9A	0.071	0.134	8.401	83	0.014	0.036	2lx9A.pdb.gz
12	PDB:6g4jA	0.071	0.059	8.401	273	0.023	0.018	6g4jA.pdb.gz
13	PDB:6o8qB	0.089	0.191	8.401	91	0.032	0.077	6o8qB.pdb.gz	Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.
14	AFDB:G5EEG1	0.094	0.065	9.230	482	0.154	0.071	G5EEG1.pdb.gz	NFYA1_CAEEL Nuclear transcription factor Y subunit nfya-1 OS=Caenorhabditis elegans OX=6239 GN=nfya-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P86478	7.75e-155	429	221	1.000	1.000	PR20E_HUMAN Proline-rich protein 20E OS=Homo sapiens OX=9606 GN=PRR20E PE=1 SV=1
2	P86479	7.75e-155	429	221	1.000	1.000	PR20C_HUMAN Proline-rich protein 20C OS=Homo sapiens OX=9606 GN=PRR20C PE=1 SV=1
3	P86480	7.75e-155	429	221	1.000	1.000	PR20D_HUMAN Proline-rich protein 20D OS=Homo sapiens OX=9606 GN=PRR20D PE=1 SV=1
4	P19334	0.003	40.8	1275	0.127	0.022	TRP_DROME Transient receptor potential protein OS=Drosophila melanogaster OX=7227 GN=trp PE=1 SV=3
5	Q05512	4.7	30.8	776	0.140	0.040	MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus OX=10090 GN=Mark2 PE=1 SV=3
6	E7ETY4	6.8	30.0	763	0.140	0.041	E7ETY4_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2
7	E9PC69	6.9	30.0	778	0.140	0.040	E9PC69_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=3
8	Q7KZI7	7.1	30.0	788	0.140	0.039	MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15708 PRR20	2.4e-95	330.2	Proline-rich protein family 20

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000438757

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367163	0.771	Belongs to the PRR20 family
2	9606.ENSP00000367164	0.771	Proline rich 20A
3	9606.ENSP00000392407	0.771	Proline rich 20D
4	9606.ENSP00000404281	0.771	Proline rich 20E
5	9606.ENSP00000427428	0.681	Protein FAM218A
6	9606.ENSP00000316137	0.636	Aspartate-rich protein 1
7	9606.ENSP00000389237	0.611	Neuroblastoma breakpoint family member 4
8	9606.ENSP00000423820	0.558	Zinc finger protein 62 homolog
9	9606.ENSP00000307951	0.557	HIG1 hypoxia inducible domain family member 2B
10	9606.ENSP00000295012	0.556	Uncharacterized protein OBSCN-AS1
11	9606.ENSP00000385118	0.556	Protein Largen
12	9606.ENSP00000469705	0.556	annotation not available
13	9606.ENSP00000484537	0.556	annotation not available
14	9606.ENSP00000485629	0.556	Uncharacterized protein LOC100507462
15	9606.ENSP00000390070	0.532	Cancer/testis antigen family 47, member A5
16	9606.ENSP00000478752	0.518	Neuroblastoma breakpoint family, member 14
17	9606.ENSP00000349456	0.504	Chloride channel CLIC-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0048518	0.957	positive regulation of biological process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0060255	0.934	regulation of macromolecule metabolic process
GO:0048522	0.892	positive regulation of cellular process
GO:0009987	0.865	cellular process
GO:0050896	0.853	response to stimulus
GO:0019219	0.785	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.749	regulation of gene expression
GO:0009889	0.737	regulation of biosynthetic process
GO:0009893	0.695	positive regulation of metabolic process
GO:0051252	0.678	regulation of RNA metabolic process
GO:0010556	0.658	regulation of macromolecule biosynthetic process
GO:0031326	0.656	regulation of cellular biosynthetic process
GO:0051173	0.614	positive regulation of nitrogen compound metabolic process
GO:0010604	0.613	positive regulation of macromolecule metabolic process
GO:0031325	0.429	positive regulation of cellular metabolic process
GO:2001141	0.405	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.475	cytoplasm
GO:0032991	0.469	protein-containing complex
GO:0140513	0.383	nuclear protein-containing complex
GO:0016020	0.367	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]