StarFunc result for job id P98066

User Input

>input (277 residues)
MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRS
ERWDAYCYNPHAKECGGVFTDPKQIFKSPGFPNEYEDNQICYWHIRLKYGQRIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98066	1.000	1.000	6.313E-58	277	1.000	1.000	P98066.pdb.gz	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
2	AFDB:B0BN34	0.781	0.787	4.459E-48	275	0.888	0.895	B0BN34.pdb.gz	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
3	AFDB:F1QRG7	0.414	0.202	2.887E-13	572	0.166	0.080	F1QRG7.pdb.gz	F1QRG7_DANRE Membrane frizzled-related protein OS=Danio rerio OX=7955 GN=si:cabz01033205.3 PE=4 SV=2
4	AFDB:Q61398	0.416	0.249	3.414E-13	468	0.184	0.109	Q61398.pdb.gz	PCOC1_MOUSE Procollagen C-endopeptidase enhancer 1 OS=Mus musculus OX=10090 GN=Pcolce PE=1 SV=2
5	AFDB:Q8R4W6	0.424	0.289	5.337E-13	414	0.188	0.126	Q8R4W6.pdb.gz	PCOC2_MOUSE Procollagen C-endopeptidase enhancer 2 OS=Mus musculus OX=10090 GN=Pcolce2 PE=2 SV=2
6	AFDB:Q9NAK5	0.391	0.260	8.344E-13	425	0.173	0.113	Q9NAK5.pdb.gz	Q9NAK5_CAEEL C-type LECtin OS=Caenorhabditis elegans OX=6239 GN=clec-4 PE=1 SV=2
7	AFDB:P98070	0.404	0.160	9.330E-13	707	0.152	0.059	P98070.pdb.gz	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
8	AFDB:O45419	0.433	0.322	1.234E-12	386	0.173	0.124	O45419.pdb.gz	O45419_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-264 PE=1 SV=2
9	AFDB:Q15113	0.421	0.264	1.234E-12	449	0.166	0.102	Q15113.pdb.gz	PCOC1_HUMAN Procollagen C-endopeptidase enhancer 1 OS=Homo sapiens OX=9606 GN=PCOLCE PE=1 SV=2
10	AFDB:Q8CIZ5	0.401	0.081	1.304E-12	1418	0.184	0.036	Q8CIZ5.pdb.gz	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
11	PDB:7b01A	0.288	0.146	7.915E-4	588	0.072	0.034	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
12	PDB:3am2A	0.247	0.241	1.730E-3	286	0.065	0.063	3am2A.pdb.gz
13	PDB:4dxzA	0.224	0.467	1.807E-2	111	0.043	0.108	4dxzA.pdb.gz
14	PDB:4tlgA	0.205	0.157	2.137E-2	396	0.072	0.051	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
15	PDB:1lr5D	0.205	0.311	2.672E-2	160	0.043	0.075	1lr5D.pdb.gz	Crystal structure of auxin-binding protein 1 in complex with auxin.
16	PDB:1zvfA	0.172	0.241	3.159E-2	176	0.054	0.085	1zvfA.pdb.gz
17	PDB:7l2zF	0.142	0.078	3.159E-2	664	0.076	0.032	7l2zF.pdb.gz
18	PDB:4uybA	0.203	0.151	3.340E-2	401	0.079	0.055	4uybA.pdb.gz
19	PDB:3lxuX	0.251	0.076	4.177E-2	1217	0.079	0.018	3lxuX.pdb.gz
20	PDB:7chjB	0.206	0.242	4.670E-2	226	0.058	0.071	7chjB.pdb.gz	Molecular basis for cysteine oxidation by plant cysteine oxidases from Arabidopsis thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0BN34	0.0	511	275	0.874	0.880	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
2	O08859	0.0	517	275	0.884	0.891	TSG6_MOUSE Tumor necrosis factor-inducible gene 6 protein OS=Mus musculus OX=10090 GN=Tnfaip6 PE=1 SV=1
3	P98066	0.0	579	277	1.000	1.000	TSG6_HUMAN Tumor necrosis factor-inducible gene 6 protein OS=Homo sapiens OX=9606 GN=TNFAIP6 PE=1 SV=2
4	Q9NY15	3.77e-29	118	2570	0.181	0.019	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3
5	Q8WWQ8	3.52e-24	104	2551	0.162	0.018	STAB2_HUMAN Stabilin-2 OS=Homo sapiens OX=9606 GN=STAB2 PE=1 SV=3
6	F6P8Y7	5.19e-24	103	2543	0.162	0.018	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
7	C6GHV6	5.44e-24	103	2508	0.162	0.018	C6GHV6_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
8	E0CZJ3	5.24e-23	100	2553	0.177	0.019	E0CZJ3_DANRE FEEL-1 OS=Danio rerio OX=7955 GN=FEEL-1 PE=1 SV=1
9	Q9TU53	1.93e-21	96.3	3620	0.177	0.014	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1
10	O70244	2.05e-21	96.3	3623	0.181	0.014	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2
11	P98063	7.86e-21	94.4	991	0.155	0.043	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
12	F1M798	8.23e-21	94.4	990	0.155	0.043	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
13	Q9VTP0	1.86e-20	93.6	3613	0.170	0.013	Q9VTP0_DROME Cubulin 2 OS=Drosophila melanogaster OX=7227 GN=Cubn2 PE=4 SV=4
14	P13497	3.11e-20	92.4	986	0.155	0.044	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
15	F1REM3	4.04e-20	92.0	976	0.155	0.044	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
16	Q2ABP1	4.17e-20	92.0	986	0.155	0.044	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
17	O43897	4.70e-20	92.0	1013	0.144	0.039	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
18	Q9JLB4	7.38e-20	91.7	3623	0.170	0.013	CUBN_MOUSE Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3
19	O60494	1.08e-19	91.3	3623	0.173	0.013	CUBN_HUMAN Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5
20	P98070	1.20e-19	90.5	707	0.155	0.061	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	6e-33	124.9	CUB domain
2	PF00193 Xlink	2.8e-27	106.2	Extracellular link domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243347

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295927	0.988	Pentraxin-related protein PTX3
2	9606.ENSP00000306512	0.984	Interleukin-8
3	9606.ENSP00000266041	0.983	Inter-alpha-trypsin inhibitor heavy chain H4
4	9606.ENSP00000451291	0.958	Heterogeneous nuclear ribonucleoproteins C1/C2
5	9606.ENSP00000265132	0.889	Protein AMBP
6	9606.ENSP00000474412	0.820	C-C motif chemokine 5
7	9606.ENSP00000346839	0.793	Fibronectin type III domain containing
8	9606.ENSP00000306884	0.759	C-X-C motif chemokine 11
9	9606.ENSP00000260356	0.755	Thrombospondin-1
10	9606.ENSP00000306991	0.743	Hyaluronan synthase 2
11	9606.ENSP00000225831	0.712	C-C motif chemokine 2
12	9606.ENSP00000356438	0.695	Prostaglandin G/H synthase 2
13	9606.ENSP00000287020	0.681	Growth/differentiation factor 6
14	9606.ENSP00000259631	0.663	C-C motif chemokine 27
15	9606.ENSP00000273283	0.658	Inter-alpha-trypsin inhibitor heavy chain H1
16	9606.ENSP00000351190	0.650	Inter-alpha-trypsin inhibitor heavy chain H2
17	9606.ENSP00000263341	0.649	Interleukin-1 beta
18	9606.ENSP00000374447	0.645	Leucine-rich repeat and calponin homology domain-containing protein 1
19	9606.ENSP00000398698	0.643	Tumor necrosis factor
20	9606.ENSP00000199447	0.642	Thioredoxin domain-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001968	1.000	fibronectin binding
GO:0052689	1.000	carboxylic ester hydrolase activity
GO:0005509	1.000	calcium ion binding
GO:0005540	0.999	hyaluronic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.993	multicellular organismal process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0032502	0.989	developmental process
GO:0048518	0.971	positive regulation of biological process
GO:0050896	0.966	response to stimulus
GO:0048856	0.955	anatomical structure development
GO:0048583	0.947	regulation of response to stimulus
GO:0048522	0.942	positive regulation of cellular process
GO:0030335	0.924	positive regulation of cell migration
GO:0007275	0.881	multicellular organism development
GO:0051716	0.847	cellular response to stimulus
GO:0048519	0.837	negative regulation of biological process
GO:0008152	0.834	metabolic process
GO:0048523	0.833	negative regulation of cellular process
GO:0051239	0.828	regulation of multicellular organismal process
GO:0002682	0.788	regulation of immune system process
GO:0023051	0.787	regulation of signaling
GO:0010646	0.787	regulation of cell communication
GO:0048585	0.778	negative regulation of response to stimulus
GO:0007154	0.739	cell communication
GO:0050793	0.737	regulation of developmental process
GO:0002683	0.729	negative regulation of immune system process
GO:0071704	0.723	organic substance metabolic process
GO:0032101	0.699	regulation of response to external stimulus
GO:0023052	0.696	signaling
GO:0009966	0.667	regulation of signal transduction
GO:0048731	0.626	system development
GO:0007165	0.618	signal transduction
GO:2000026	0.589	regulation of multicellular organismal development
GO:0006807	0.573	nitrogen compound metabolic process
GO:0051241	0.545	negative regulation of multicellular organismal process
GO:0043170	0.517	macromolecule metabolic process
GO:0006950	0.513	response to stress
GO:0080134	0.508	regulation of response to stress
GO:0009968	0.507	negative regulation of signal transduction
GO:0051093	0.499	negative regulation of developmental process
GO:1901564	0.482	organonitrogen compound metabolic process
GO:0045595	0.460	regulation of cell differentiation
GO:0048584	0.448	positive regulation of response to stimulus
GO:0042221	0.404	response to chemical
GO:0019222	0.395	regulation of metabolic process
GO:0048609	0.395	multicellular organismal reproductive process
GO:0006952	0.394	defense response
GO:0007292	0.388	female gamete generation
GO:0045596	0.385	negative regulation of cell differentiation
GO:1903706	0.346	regulation of hemopoiesis
GO:0071840	0.337	cellular component organization or biogenesis
GO:0032879	0.319	regulation of localization
GO:0060255	0.318	regulation of macromolecule metabolic process
GO:0006954	0.317	inflammatory response
GO:0016043	0.301	cellular component organization
GO:0002685	0.300	regulation of leukocyte migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.957	extracellular space
GO:0012505	0.955	endomembrane system
GO:0005622	0.920	intracellular anatomical structure
GO:0043227	0.907	membrane-bounded organelle
GO:0005737	0.902	cytoplasm
GO:0043231	0.892	intracellular membrane-bounded organelle
GO:0031974	0.888	membrane-enclosed lumen
GO:0070013	0.880	intracellular organelle lumen
GO:0071944	0.762	cell periphery
GO:0031410	0.728	cytoplasmic vesicle
GO:0016020	0.707	membrane
GO:0031981	0.325	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.

[back to server]