StarFunc result for job id P98073

User Input

>input (1019 residues)
MGSKRGISSRHHSLSSYEIMFAALFAILVVLCAGLIAVSCLTIKESQRGAALGQSHEARA
TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSII
VVFDLFFAQWVSDENVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATPGNV
SIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDGRFLLTGSSGSFQA
THYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYTDILDIYEGVGSSKILRASIWETN
PGTIRIFSNQVTATFLIESDESDYVGFNATYTAFNSSELNNYEKINCNFEDGFCFWVQDL
NDDNEWERIQGSTFSPFTGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEP
ACLSFWYHMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKVAFN
AFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGPFELWEPNTTFSST
NFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGEEADSLLLAVYTGPG
PVKDVFSTTNRMTVLLITNDVLARGGFKANFTTGYHLGIPEPCKADHFQCKNGECVPLVN
LCDGHLHCEDGSDEADCVRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLG
LGSGNSSKPIFPTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLAAQD
ITPKIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEPSKWTAI
LGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEFKVNYTDYIQPICLPEE
NQVFPPGRNCSIAGWGTVVYQGTTANILQEADVPLLSNERCQQQMPEYNITENMICAGYE
EGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98072	0.567	0.560	0.000	1035	0.823	0.811	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
2	AFDB:P98073	1.000	1.000	0.000	1019	1.000	1.000	P98073.pdb.gz	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
3	AFDB:A5PMY0	0.232	0.282	2.035E-50	834	0.212	0.259	A5PMY0.pdb.gz	A5PMY0_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14 PE=1 SV=1
4	AFDB:P56677	0.238	0.283	6.909E-50	855	0.220	0.262	P56677.pdb.gz	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
5	AFDB:Q9DBI0	0.236	0.294	1.800E-48	811	0.191	0.240	Q9DBI0.pdb.gz	TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus OX=10090 GN=Tmprss6 PE=1 SV=4
6	AFDB:Q9Y5Y6	0.247	0.293	2.322E-48	855	0.217	0.258	Q9Y5Y6.pdb.gz	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
7	AFDB:Q8IU80	0.236	0.294	7.494E-48	811	0.186	0.234	Q8IU80.pdb.gz	TMPS6_HUMAN Transmembrane protease serine 6 OS=Homo sapiens OX=9606 GN=TMPRSS6 PE=1 SV=3
8	AFDB:Q8BIK6	0.232	0.283	8.213E-47	829	0.191	0.235	Q8BIK6.pdb.gz	TMPS7_MOUSE Transmembrane protease serine 7 OS=Mus musculus OX=10090 GN=Tmprss7 PE=1 SV=3
9	AFDB:Q6Q1Q9	0.240	0.351	2.227E-39	686	0.153	0.227	Q6Q1Q9.pdb.gz	Q6Q1Q9_CHICK Mannan-binding lectin associated serine protease 2 OS=Gallus gallus OX=9031 PE=2 SV=1
10	AFDB:Q9JJS8	0.234	0.343	7.562E-39	685	0.146	0.218	Q9JJS8.pdb.gz	MASP2_RAT Mannan-binding lectin serine protease 2 OS=Rattus norvegicus OX=10116 GN=Masp2 PE=1 SV=2
11	PDB:6i44A	0.232	0.387	5.025E-25	594	0.136	0.234	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
12	PDB:4bnrA	0.220	0.918	3.481E-24	237	0.083	0.359	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
13	PDB:1fiwA	0.220	0.835	1.231E-22	260	0.090	0.354	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
14	PDB:1cgiE	0.218	0.877	2.512E-22	245	0.083	0.347	1cgiE.pdb.gz
15	PDB:2ra3A	0.210	0.929	9.940E-22	224	0.084	0.384	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
16	PDB:2a31A	0.210	0.932	1.927E-21	223	0.085	0.390	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
17	PDB:1a0lA	0.216	0.868	2.616E-21	244	0.082	0.344	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
18	PDB:4h4fA	0.219	0.912	6.545E-21	239	0.077	0.326	4h4fA.pdb.gz	Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
19	PDB:4a5tS	0.222	0.292	6.887E-21	767	0.097	0.129	4a5tS.pdb.gz
20	PDB:2a7jA	0.216	0.888	1.089E-20	240	0.074	0.312	2a7jA.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part III. The optimal data-collection wavelength.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98072	0.0	1775	1035	0.824	0.812	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
2	P98073	0.0	2117	1019	1.000	1.000	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
3	D3ZY65	4.74e-71	246	475	0.143	0.307	D3ZY65_RAT Transmembrane serine protease 3 OS=Rattus norvegicus OX=10116 GN=Tmprss3 PE=4 SV=3
4	Q8K1T0	2.06e-69	241	453	0.139	0.313	TMPS3_MOUSE Transmembrane protease serine 3 OS=Mus musculus OX=10090 GN=Tmprss3 PE=1 SV=2
5	P57727	1.37e-68	238	454	0.136	0.306	TMPS3_HUMAN Transmembrane protease serine 3 OS=Homo sapiens OX=9606 GN=TMPRSS3 PE=1 SV=2
6	C9JKZ3	5.54e-68	238	489	0.134	0.280	C9JKZ3_HUMAN Transmembrane protease serine 2 (Fragment) OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=1
7	O15393	6.21e-68	238	492	0.134	0.278	TMPS2_HUMAN Transmembrane protease serine 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=3
8	Q9JIQ8	4.24e-66	233	490	0.129	0.267	TMPS2_MOUSE Transmembrane protease serine 2 OS=Mus musculus OX=10090 GN=Tmprss2 PE=2 SV=3
9	A0A8I6AEJ8	3.77e-65	238	820	0.169	0.210	A0A8I6AEJ8_RAT ST14 transmembrane serine protease matriptase OS=Rattus norvegicus OX=10116 GN=St14 PE=4 SV=1
10	Q9Y5Y6	2.26e-64	236	855	0.174	0.207	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
11	Q1RLP8	8.43e-62	228	827	0.164	0.202	Q1RLP8_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14a PE=2 SV=1
12	A5PMY0	1.09e-61	228	834	0.164	0.200	A5PMY0_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14 PE=1 SV=1
13	Q9JJI7	1.35e-61	228	855	0.172	0.205	Q9JJI7_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=1 SV=1
14	P56677	1.55e-61	228	855	0.176	0.209	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
15	A0A8I6ARC9	1.62e-61	228	846	0.172	0.207	A0A8I6ARC9_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=3 SV=1
16	C9J5Y1	9.37e-61	216	452	0.117	0.263	C9J5Y1_HUMAN Transmembrane serine protease 2 OS=Homo sapiens OX=9606 GN=TMPRSS2 PE=1 SV=2
17	E7EQE7	3.83e-60	224	903	0.134	0.152	E7EQE7_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
18	J3KR90	5.85e-60	225	1005	0.134	0.136	J3KR90_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
19	A0A087X1D5	6.28e-60	224	938	0.134	0.146	A0A087X1D5_HUMAN Corin, serine peptidase OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=1
20	Q9Y5Q5	7.94e-60	225	1042	0.134	0.131	CORIN_HUMAN Atrial natriuretic peptide-converting enzyme OS=Homo sapiens OX=9606 GN=CORIN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	6.2e-45	163.4	CUB domain
2	PF09342 DUF1986	2.8e-05	35.8	Domain of unknown function (DUF1986)
3	PF00057 Ldl_recept_a	1.8e-11	55.3	Low-density lipoprotein receptor domain class A
4	PF00629 MAM	1.2e-37	140.7	MAM domain, meprin/A5/mu
5	PF01390 SEA	6e-15	66.7	SEA domain
6	PF00530 SRCR	0.0012	30.5	Scavenger receptor cysteine-rich domain
7	PF15494 SRCR_2	0.00032	32.7	Scavenger receptor cysteine-rich domain
8	PF00089 Trypsin	7.6e-68	240.2	Trypsin
9	PF09363 XFP_C	46	14.9	XFP C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284885

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253577	0.779	ATP-binding cassette sub-family B member 7, mitochondrial
2	9606.ENSP00000368678	0.776	Agrin
3	9606.ENSP00000296695	0.772	Serine protease inhibitor Kazal-type 1
4	9606.ENSP00000275560	0.698	Scavenger receptor cysteine-rich domain-containing group B protein
5	9606.ENSP00000381293	0.690	Vesicle-fusing ATPase
6	9606.ENSP00000363641	0.641	Thioredoxin
7	9606.ENSP00000353462	0.627	Cas scaffolding protein family member 4
8	9606.ENSP00000363634	0.623	Thioredoxin domain-containing protein 8
9	9606.ENSP00000284881	0.608	Protein EURL homolog
10	9606.ENSP00000295736	0.607	Sodium bicarbonate cotransporter 3
11	9606.ENSP00000393066	0.607	Sodium-driven chloride bicarbonate exchanger
12	9606.ENSP00000405812	0.607	Electroneutral sodium bicarbonate exchanger 1
13	9606.ENSP00000377900	0.596	Lipase F, gastric type
14	9606.ENSP00000302716	0.587	Mucin-17
15	9606.ENSP00000381008	0.575	Mucin-16
16	9606.ENSP00000385828	0.573	Thiosulfate sulfurtransferase
17	9606.ENSP00000369274	0.571	Phosphorylase b kinase regulatory subunit alpha, liver isoform
18	9606.ENSP00000295897	0.568	Serum albumin
19	9606.ENSP00000299022	0.568	Hepatic triacylglycerol lipase
20	9606.ENSP00000441929	0.558	Mucin-12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008233	1.000	peptidase activity
GO:0017171	0.998	serine hydrolase activity
GO:0008236	0.969	serine-type peptidase activity
GO:0004175	0.347	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.958	multicellular organismal process
GO:0071704	0.952	organic substance metabolic process
GO:0044238	0.932	primary metabolic process
GO:0006807	0.916	nitrogen compound metabolic process
GO:0007586	0.911	digestion
GO:1901564	0.904	organonitrogen compound metabolic process
GO:0006508	0.890	proteolysis
GO:0016485	0.708	protein processing
GO:0009987	0.686	cellular process
GO:0031638	0.626	zymogen activation
GO:0065007	0.570	biological regulation
GO:0050789	0.351	regulation of biological process
GO:0050794	0.321	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.994	membrane
GO:0071944	0.962	cell periphery
GO:0005886	0.952	plasma membrane
GO:0005576	0.915	extracellular region
GO:0043227	0.818	membrane-bounded organelle
GO:0005737	0.801	cytoplasm
GO:0005615	0.780	extracellular space
GO:0043229	0.753	intracellular organelle
GO:0043231	0.709	intracellular membrane-bounded organelle
GO:0070013	0.389	intracellular organelle lumen
GO:0098862	0.309	cluster of actin-based cell projections

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]