StarFunc result for job id P98077

User Input

>input (582 residues)
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPGGFLGRGPAAARAAGASGGA
DPQPEPAGPGGVPALAAAVLGACEPRCAAPCPLPALSRCRGAGSRGSRGGRGAAGSGDAA
AAAEWIRKGSFIHKPAHGWLHPDARVLGPGVSYVVRYMGCIEVLRSMRSLDFNTRTQVTR
EAINRLHEAVPGVRGSWKKKAPNKALASVLGKSNLRFAGMSISIHISTDGLSLSVPATRQ
VIANHHMPSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFEL
RFKQYLHSPPKVALPPERLAGPEESAWGDEEDSLEHNYYNSIPGKEPPLGGLVDSRLALT
QPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGL
DAPEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSPPTRRAPVAPTEE
QLRQEPWYHGRMSRRAAERMLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGV
VRTKDVLFESISHLIDHHLQNGQPIVAAESELHLRGVVSREP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98077	1.000	1.000	1.535E-103	582	1.000	1.000	P98077.pdb.gz	SHC2_HUMAN SHC-transforming protein 2 OS=Homo sapiens OX=9606 GN=SHC2 PE=1 SV=4
2	AFDB:O70143	0.344	0.338	4.818E-51	594	0.471	0.461	O70143.pdb.gz	SHC3_RAT SHC-transforming protein 3 OS=Rattus norvegicus OX=10116 GN=Shc3 PE=2 SV=1
3	AFDB:E7F3T0	0.348	0.437	1.072E-49	454	0.431	0.553	E7F3T0.pdb.gz	E7F3T0_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=2
4	AFDB:Q24080	0.298	0.412	5.348E-36	409	0.284	0.403	Q24080.pdb.gz	Q24080_DROME DShc OS=Drosophila melanogaster OX=7227 GN=Shc PE=2 SV=1
5	AFDB:A1L1I3	0.226	0.215	1.274E-11	614	0.134	0.127	A1L1I3.pdb.gz	NUMBL_RAT Numb-like protein OS=Rattus norvegicus OX=10116 GN=Numbl PE=1 SV=1
6	AFDB:A0A2R8QR19	0.167	0.115	1.053E-7	862	0.103	0.070	A0A2R8QR19.pdb.gz
7	AFDB:Q8CJH2	0.201	0.211	2.948E-6	555	0.105	0.110	Q8CJH2.pdb.gz	DAB1_RAT Disabled homolog 1 OS=Rattus norvegicus OX=10116 GN=Dab1 PE=1 SV=1
8	AFDB:A0A024R036	0.213	0.163	1.652E-5	770	0.077	0.058	A0A024R036.pdb.gz
9	AFDB:A0A2R8Q5X5	0.134	0.147	1.652E-5	528	0.091	0.100	A0A2R8Q5X5.pdb.gz
10	PDB:3ps5A	0.154	0.169	2.130E-5	529	0.050	0.055	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
11	PDB:8dcxB	0.152	0.356	2.256E-5	236	0.058	0.144	8dcxB.pdb.gz
12	PDB:1griA	0.150	0.386	3.572E-5	211	0.052	0.142	1griA.pdb.gz
13	PDB:1k9aB	0.148	0.193	5.042E-5	441	0.048	0.063	1k9aB.pdb.gz
14	AFDB:X2JE74	0.211	0.108	5.522E-5	1170	0.095	0.047	X2JE74.pdb.gz	X2JE74_DROME X11L, isoform F OS=Drosophila melanogaster OX=7227 GN=X11L PE=4 SV=1
15	PDB:4fl2A	0.149	0.156	8.955E-5	555	0.043	0.045	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:4k2rA	0.139	0.147	2.002E-4	551	0.045	0.047	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:4gwfA	0.147	0.171	2.993E-4	497	0.046	0.054	4gwfA.pdb.gz
18	PDB:5xzrA	0.140	0.156	2.993E-4	519	0.053	0.060	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
19	PDB:1ka6A	0.138	0.674	4.739E-4	107	0.045	0.243	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
20	PDB:3cxlA	0.105	0.149	5.019E-4	402	0.041	0.060	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98077	0.0	1179	582	1.000	1.000	SHC2_HUMAN SHC-transforming protein 2 OS=Homo sapiens OX=9606 GN=SHC2 PE=1 SV=4
2	P98083	4.59e-166	486	579	0.490	0.492	SHC1_MOUSE SHC-transforming protein 1 OS=Mus musculus OX=10090 GN=Shc1 PE=1 SV=3
3	P29353	6.93e-166	486	583	0.495	0.494	SHC1_HUMAN SHC-transforming protein 1 OS=Homo sapiens OX=9606 GN=SHC1 PE=1 SV=4
4	Q5M824	2.95e-165	480	469	0.440	0.546	SHC1_RAT SHC-transforming protein 1 OS=Rattus norvegicus OX=10116 GN=Shc1 PE=1 SV=1
5	Q0IIE2	4.05e-163	475	473	0.447	0.550	SHC1_BOVIN SHC-transforming protein 1 OS=Bos taurus OX=9913 GN=SHC1 PE=2 SV=1
6	Q61120	8.09e-156	456	474	0.442	0.542	SHC3_MOUSE SHC-transforming protein 3 OS=Mus musculus OX=10090 GN=Shc3 PE=1 SV=2
7	O70143	3.15e-155	459	594	0.455	0.446	SHC3_RAT SHC-transforming protein 3 OS=Rattus norvegicus OX=10116 GN=Shc3 PE=2 SV=1
8	Q92529	7.36e-154	456	594	0.450	0.441	SHC3_HUMAN SHC-transforming protein 3 OS=Homo sapiens OX=9606 GN=SHC3 PE=1 SV=1
9	E9QCZ8	5.54e-153	448	449	0.443	0.575	E9QCZ8_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=1
10	E7F3T0	7.40e-153	448	454	0.443	0.568	E7F3T0_DANRE SHC (Src homology 2 domain-containing)-transforming protein 1 OS=Danio rerio OX=7955 GN=shc1 PE=4 SV=2
11	Q6S5L8	7.10e-124	380	630	0.426	0.394	SHC4_HUMAN SHC-transforming protein 4 OS=Homo sapiens OX=9606 GN=SHC4 PE=1 SV=1
12	Q6S5L9	7.94e-122	375	626	0.376	0.350	SHC4_MOUSE SHC-transforming protein 4 OS=Mus musculus OX=10090 GN=Shc4 PE=1 SV=1
13	Q9Z1I0	2.70e-58	193	138	0.153	0.645	Q9Z1I0_RAT Shc transforming protein (Fragment) OS=Rattus norvegicus OX=10116 GN=shc PE=2 SV=1
14	Q9V3C8	2.17e-44	164	409	0.156	0.222	Q9V3C8_DROME DShc protein OS=Drosophila melanogaster OX=7227 GN=Shc PE=1 SV=1
15	Q24080	2.10e-43	162	409	0.155	0.220	Q24080_DROME DShc OS=Drosophila melanogaster OX=7227 GN=Shc PE=2 SV=1
16	Q9TYT3	1.33e-18	89.4	316	0.076	0.139	SHCH1_CAEEL SHC-transforming protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=shc-1 PE=1 SV=2
17	P16591	4.45e-12	71.6	822	0.058	0.041	FER_HUMAN Tyrosine-protein kinase Fer OS=Homo sapiens OX=9606 GN=FER PE=1 SV=2
18	W0S0X4	4.45e-12	71.6	822	0.058	0.041	W0S0X4_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=Pe1Fe3 PE=2 SV=1
19	P09760	1.13e-11	70.1	823	0.058	0.041	FER_RAT Tyrosine-protein kinase Fer OS=Rattus norvegicus OX=10116 GN=Fer PE=1 SV=2
20	P70451	1.30e-11	70.1	823	0.057	0.040	FER_MOUSE Tyrosine-protein kinase Fer OS=Mus musculus OX=10090 GN=Fer PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	3.8e-44	161.6	Phosphotyrosine interaction domain (PTB/PID)
2	PF00017 SH2	4e-13	60.6	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263923	0.991	Vascular endothelial growth factor receptor 2
2	9606.ENSP00000282397	0.979	Vascular endothelial growth factor receptor 1
3	9606.ENSP00000275493	0.974	Epidermal growth factor receptor
4	9606.ENSP00000277120	0.966	BDNF/NT-3 growth factors receptor
5	9606.ENSP00000376345	0.965	Growth factor receptor-bound protein 2
6	9606.ENSP00000431418	0.962	High affinity nerve growth factor receptor
7	9606.ENSP00000269571	0.945	Receptor tyrosine-protein kinase erbB-2
8	9606.ENSP00000407586	0.920	GTPase HRas
9	9606.ENSP00000342235	0.917	Receptor tyrosine-protein kinase erbB-4
10	9606.ENSP00000478570	0.917	Vascular endothelial growth factor A
11	9606.ENSP00000256078	0.915	GTPase KRas
12	9606.ENSP00000401303	0.913	SHC-transforming protein 1
13	9606.ENSP00000358548	0.912	GTPase NRas
14	9606.ENSP00000267101	0.911	Receptor tyrosine-protein kinase erbB-3
15	9606.ENSP00000358525	0.910	Beta-nerve growth factor
16	9606.ENSP00000362680	0.909	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000414303	0.908	Brain-derived neurotrophic factor
18	9606.ENSP00000262995	0.878	GRB2-associated-binding protein 1
19	9606.ENSP00000387784	0.874	Son of sevenless homolog 1
20	9606.ENSP00000216373	0.866	Son of sevenless homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.498	signaling receptor binding
GO:0019899	0.415	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0050896	0.996	response to stimulus
GO:0051716	0.992	cellular response to stimulus
GO:0007165	0.980	signal transduction
GO:0007166	0.885	cell surface receptor signaling pathway
GO:0048518	0.860	positive regulation of biological process
GO:0048522	0.846	positive regulation of cellular process
GO:0023051	0.817	regulation of signaling
GO:0010646	0.817	regulation of cell communication
GO:0048583	0.799	regulation of response to stimulus
GO:0019222	0.767	regulation of metabolic process
GO:0009966	0.726	regulation of signal transduction
GO:0048584	0.679	positive regulation of response to stimulus
GO:0060255	0.652	regulation of macromolecule metabolic process
GO:0007167	0.649	enzyme-linked receptor protein signaling pathway
GO:0032502	0.636	developmental process
GO:0007169	0.632	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048856	0.591	anatomical structure development
GO:0042127	0.563	regulation of cell population proliferation
GO:1902531	0.560	regulation of intracellular signal transduction
GO:0032501	0.532	multicellular organismal process
GO:0051171	0.511	regulation of nitrogen compound metabolic process
GO:0080090	0.494	regulation of primary metabolic process
GO:0031323	0.485	regulation of cellular metabolic process
GO:0009893	0.451	positive regulation of metabolic process
GO:0009967	0.440	positive regulation of signal transduction
GO:0048519	0.431	negative regulation of biological process
GO:0035556	0.406	intracellular signal transduction
GO:0031325	0.396	positive regulation of cellular metabolic process
GO:0010604	0.390	positive regulation of macromolecule metabolic process
GO:0050790	0.382	regulation of catalytic activity
GO:1902533	0.381	positive regulation of intracellular signal transduction
GO:0051246	0.378	regulation of protein metabolic process
GO:0007275	0.375	multicellular organism development
GO:0008284	0.374	positive regulation of cell population proliferation
GO:0008152	0.365	metabolic process
GO:0042325	0.362	regulation of phosphorylation
GO:0043408	0.360	regulation of MAPK cascade
GO:0048523	0.348	negative regulation of cellular process
GO:0051173	0.347	positive regulation of nitrogen compound metabolic process
GO:0043410	0.346	positive regulation of MAPK cascade
GO:0010468	0.344	regulation of gene expression
GO:0042221	0.331	response to chemical
GO:0071704	0.329	organic substance metabolic process
GO:0031399	0.325	regulation of protein modification process
GO:0048731	0.319	system development
GO:0001932	0.306	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.978	plasma membrane
GO:0043229	0.438	intracellular organelle
GO:0043231	0.409	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]