StarFunc result for job id P98082

User Input

>input (770 residues)
MSNEVETSATNGQPDQQAAPKAPSKKEKKKGPEKTDEYLLARFKGDGVKYKAKLIGIDDV
PDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNK
ISFIARDVTDNRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEEASKAVENGSEALMILDDQTNKLKSGVDQMDLFGDMSTPPDLNSPTESKDILLVDLN
SEIDTNQNSLRENPFLTNGITSCSLPRPTPQASFLPENAFSANLNFFPTPNPDPFRDDPF
TQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQ
AGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNPFVGSPPKGLSIQNGVKQDLESSV
QSSPHDSIAIIPPPQSTKPGRGRRTAKSSANDLLASDIFAPPVSEPSGQASPTGQPTALQ
PNPLDLFKTSAPAPVGPLVGLGGVTVTLPQAGPWNTASLVFNQSPSMAPGAMMGGQPSGF
SQPVIFGTSPAVSGWNQPSPFAASTPPPVPVVWGPSASVAPNAWSTTSPLGNPFQSNIFP
APAVSTQPPSMHSSLLVTPPQPPPRAGPPKDISSDAFTALDPLGDKEIKDVKEMFKDFQL
RQPPAVPARKGEQTSSGTLSAFASYFNSKVGIPQENADHDDFDANQLLNKINEPPKPAPR
QVSLPVTKSTDNAFENPFFKDSFGSSQASVASSQPVSSEMYRDPFGNPFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R036	0.253	0.253	8.314E-99	770	1.000	1.000	A0A024R036.pdb.gz
2	AFDB:O88797	0.443	0.444	1.986E-87	768	0.834	0.836	O88797.pdb.gz	DAB2_RAT Disabled homolog 2 OS=Rattus norvegicus OX=10116 GN=Dab2 PE=1 SV=1
3	AFDB:B8A566	0.253	0.246	2.302E-43	797	0.417	0.403	B8A566.pdb.gz
4	AFDB:F1QHL0	0.126	0.099	3.795E-5	1032	0.156	0.116	F1QHL0.pdb.gz
5	AFDB:O14654	0.118	0.077	1.534E-3	1257	0.155	0.095	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
6	AFDB:Q9Z0Y7	0.114	0.075	2.078E-3	1216	0.152	0.096	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
7	AFDB:Q9DF49	0.110	0.081	2.648E-3	1074	0.135	0.097	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
8	AFDB:F1MAL5	0.113	0.068	3.586E-3	1327	0.135	0.078	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
9	AFDB:Q07436	0.084	0.056	4.049E-3	1427	0.151	0.081	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
10	AFDB:Q55BY0	0.073	0.071	4.302E-3	798	0.132	0.128	Q55BY0.pdb.gz	Q55BY0_DICDI Autophagy-related protein 13 N-terminal domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269162 PE=4 SV=1
11	PDB:6e5lA	0.060	0.236	8.423E-3	140	0.021	0.114	6e5lA.pdb.gz	Abnormal Cannabidiol Modulates Vitamin A Metabolism by Acting as a Competitive Inhibitor of CRBP1.
12	PDB:4gouA	0.110	0.161	1.010E-2	507	0.019	0.030	4gouA.pdb.gz
13	PDB:3m1iB	0.104	0.494	1.545E-2	131	0.032	0.191	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
14	PDB:5yqrA	0.104	0.271	1.641E-2	268	0.014	0.041	5yqrA.pdb.gz
15	PDB:6r9tA	0.092	0.033	2.092E-2	2185	0.017	0.006	6r9tA.pdb.gz
16	PDB:7nsb7	0.055	0.074	3.010E-2	531	0.016	0.023	7nsb7.pdb.gz
17	PDB:6oxlN	0.101	0.471	3.198E-2	124	0.021	0.129	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
18	PDB:4rm8A	0.095	0.190	3.398E-2	368	0.016	0.033	4rm8A.pdb.gz
19	PDB:2rctA	0.063	0.249	4.331E-2	141	0.014	0.078	2rctA.pdb.gz	Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
20	PDB:7rx9A	0.096	0.165	6.622E-2	432	0.010	0.019	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88797	0.0	1164	768	0.835	0.837	DAB2_RAT Disabled homolog 2 OS=Rattus norvegicus OX=10116 GN=Dab2 PE=1 SV=1
2	P98078	0.0	1174	766	0.836	0.841	DAB2_MOUSE Disabled homolog 2 OS=Mus musculus OX=10090 GN=Dab2 PE=1 SV=2
3	P98082	0.0	1545	770	1.000	1.000	DAB2_HUMAN Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3
4	F6NGQ6	7.66e-101	325	589	0.201	0.263	F6NGQ6_DANRE DAB adaptor protein 2 OS=Danio rerio OX=7955 GN=sb:cb778 PE=1 SV=1
5	Q6XBN7	4.66e-73	249	535	0.148	0.213	Q6XBN7_CHICK Disabled-1 early isoform OS=Gallus gallus OX=9031 GN=Dab1 PE=2 SV=1
6	Q8CJH2	3.06e-70	242	555	0.158	0.220	DAB1_RAT Disabled homolog 1 OS=Rattus norvegicus OX=10116 GN=Dab1 PE=1 SV=1
7	X6R4J9	9.55e-67	221	204	0.131	0.495	X6R4J9_HUMAN DAB adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAB1 PE=1 SV=1
8	A0A3G6VF52	1.37e-65	231	588	0.135	0.177	A0A3G6VF52_HUMAN DAB1 OS=Homo sapiens OX=9606 GN=DAB1 PE=2 SV=1
9	O75553	1.37e-65	231	588	0.135	0.177	DAB1_HUMAN Disabled homolog 1 OS=Homo sapiens OX=9606 GN=DAB1 PE=1 SV=3
10	P97318	1.46e-65	230	588	0.135	0.177	DAB1_MOUSE Disabled homolog 1 OS=Mus musculus OX=10090 GN=Dab1 PE=1 SV=2
11	H0ZH85	4.46e-65	228	557	0.151	0.208	H0ZH85_TAEGU DAB adaptor protein 1 OS=Taeniopygia guttata OX=59729 GN=DAB1 PE=4 SV=2
12	P98081	6.45e-39	158	2224	0.095	0.033	DAB_DROME Protein disabled OS=Drosophila melanogaster OX=7227 GN=Dab PE=1 SV=2
13	Q8I4H0	2.43e-36	145	490	0.113	0.178	Q8I4H0_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dab-1 PE=1 SV=4
14	Q9U3A6	2.65e-36	145	492	0.113	0.177	Q9U3A6_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dab-1 PE=1 SV=4
15	Q8I4G9	1.55e-35	143	474	0.095	0.154	Q8I4G9_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dab-1 PE=1 SV=3
16	A5JYR4	2.16e-35	143	492	0.114	0.179	A5JYR4_CAEEL PID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dab-1 PE=1 SV=2
17	A0A075B6G7	2.92e-35	136	239	0.113	0.364	A0A075B6G7_HUMAN DAB adaptor protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAB1 PE=1 SV=1
18	Q9UBP9	1.69e-14	77.4	304	0.058	0.148	GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens OX=9606 GN=GULP1 PE=1 SV=1
19	F1RDZ7	4.17e-09	62.4	669	0.053	0.061	F1RDZ7_DANRE NUMB endocytic adaptor protein OS=Danio rerio OX=7955 GN=numb PE=4 SV=1
20	O76337	8.12e-09	61.2	492	0.052	0.081	CED6_CAEEL Cell death protein 6 OS=Caenorhabditis elegans OX=6239 GN=ced-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00640 PID	0.00013	33.4	Phosphotyrosine interaction domain (PTB/PID)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313391

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263816	0.992	Low-density lipoprotein receptor-related protein 2
2	9606.ENSP00000364133	0.988	TGF-beta receptor type-1
3	9606.ENSP00000358994	0.982	Unconventional myosin-VI
4	9606.ENSP00000259371	0.980	Disabled homolog 2-interacting protein
5	9606.ENSP00000454071	0.979	Low-density lipoprotein receptor
6	9606.ENSP00000262160	0.964	Mothers against decapentaplegic homolog 2
7	9606.ENSP00000376345	0.964	Growth factor receptor-bound protein 2
8	9606.ENSP00000380921	0.964	SH3 domain-containing kinase-binding protein 1
9	9606.ENSP00000351905	0.962	TGF-beta receptor type-2
10	9606.ENSP00000332973	0.942	Mothers against decapentaplegic homolog 3
11	9606.ENSP00000360798	0.936	Epidermal growth factor receptor substrate 15
12	9606.ENSP00000479606	0.931	Clathrin heavy chain 1
13	9606.ENSP00000238682	0.915	Transforming growth factor beta-3
14	9606.ENSP00000362680	0.914	Proto-oncogene tyrosine-protein kinase Src
15	9606.ENSP00000221930	0.912	Transforming growth factor beta-1
16	9606.ENSP00000393776	0.905	F-BAR domain only protein 2
17	9606.ENSP00000303634	0.895	Low-density lipoprotein receptor-related protein 8
18	9606.ENSP00000284981	0.881	Amyloid-beta A4 protein
19	9606.ENSP00000316054	0.864	Segment polarity protein dishevelled homolog DVL-3
20	9606.ENSP00000363458	0.861	Low density lipoprotein receptor adapter protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030276	0.999	clathrin binding
GO:0050750	0.923	low-density lipoprotein particle receptor binding
GO:0030674	0.503	protein-macromolecule adaptor activity
GO:0140312	0.440	cargo adaptor activity
GO:0038024	0.434	cargo receptor activity
GO:0035615	0.428	clathrin adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051239	0.987	regulation of multicellular organismal process
GO:0031328	0.987	positive regulation of cellular biosynthetic process
GO:0050896	0.986	response to stimulus
GO:0009967	0.985	positive regulation of signal transduction
GO:0045807	0.981	positive regulation of endocytosis
GO:0006355	0.977	regulation of DNA-templated transcription
GO:1902531	0.974	regulation of intracellular signal transduction
GO:0032502	0.972	developmental process
GO:0001932	0.969	regulation of protein phosphorylation
GO:0048523	0.966	negative regulation of cellular process
GO:0051254	0.966	positive regulation of RNA metabolic process
GO:0009968	0.964	negative regulation of signal transduction
GO:0050793	0.963	regulation of developmental process
GO:1902680	0.963	positive regulation of RNA biosynthetic process
GO:0060393	0.941	regulation of pathway-restricted SMAD protein phosphorylation
GO:0060341	0.932	regulation of cellular localization
GO:0051247	0.931	positive regulation of protein metabolic process
GO:0051240	0.915	positive regulation of multicellular organismal process
GO:1904375	0.912	regulation of protein localization to cell periphery
GO:0090092	0.900	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0045893	0.894	positive regulation of DNA-templated transcription
GO:0070848	0.889	response to growth factor
GO:0048856	0.882	anatomical structure development
GO:0045595	0.881	regulation of cell differentiation
GO:0065009	0.852	regulation of molecular function
GO:0051716	0.844	cellular response to stimulus
GO:1905475	0.802	regulation of protein localization to membrane
GO:0016043	0.795	cellular component organization
GO:0009892	0.737	negative regulation of metabolic process
GO:0090287	0.732	regulation of cellular response to growth factor stimulus
GO:0007165	0.692	signal transduction
GO:0032501	0.685	multicellular organismal process
GO:0007166	0.635	cell surface receptor signaling pathway
GO:0010717	0.621	regulation of epithelial to mesenchymal transition
GO:0043408	0.602	regulation of MAPK cascade
GO:0045937	0.601	positive regulation of phosphate metabolic process
GO:0006357	0.569	regulation of transcription by RNA polymerase II
GO:0051179	0.564	localization
GO:0030155	0.550	regulation of cell adhesion
GO:1903076	0.542	regulation of protein localization to plasma membrane
GO:0042327	0.539	positive regulation of phosphorylation
GO:0071495	0.537	cellular response to endogenous stimulus
GO:0045597	0.518	positive regulation of cell differentiation
GO:0001934	0.512	positive regulation of protein phosphorylation
GO:0048869	0.474	cellular developmental process
GO:0042221	0.473	response to chemical
GO:0006810	0.466	transport
GO:0010941	0.463	regulation of cell death
GO:2000145	0.457	regulation of cell motility
GO:1902533	0.452	positive regulation of intracellular signal transduction
GO:0007275	0.425	multicellular organism development
GO:0030334	0.424	regulation of cell migration
GO:0071704	0.420	organic substance metabolic process
GO:0071363	0.419	cellular response to growth factor stimulus
GO:0042981	0.416	regulation of apoptotic process
GO:0030154	0.415	cell differentiation
GO:0010810	0.414	regulation of cell-substrate adhesion
GO:0030335	0.403	positive regulation of cell migration
GO:0060548	0.397	negative regulation of cell death
GO:0050790	0.393	regulation of catalytic activity
GO:0042127	0.391	regulation of cell population proliferation
GO:0048259	0.386	regulation of receptor-mediated endocytosis
GO:0022607	0.374	cellular component assembly
GO:0065008	0.373	regulation of biological quality
GO:0010718	0.366	positive regulation of epithelial to mesenchymal transition
GO:0048260	0.365	positive regulation of receptor-mediated endocytosis
GO:0045785	0.328	positive regulation of cell adhesion
GO:0010033	0.324	response to organic substance
GO:0030111	0.309	regulation of Wnt signaling pathway
GO:0010605	0.304	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0070013	0.996	intracellular organelle lumen
GO:0031981	0.993	nuclear lumen
GO:0005829	0.974	cytosol
GO:0043232	0.965	intracellular non-membrane-bounded organelle
GO:0031090	0.939	organelle membrane
GO:0031410	0.919	cytoplasmic vesicle
GO:0098590	0.908	plasma membrane region
GO:0032991	0.889	protein-containing complex
GO:0098588	0.850	bounding membrane of organelle
GO:0012506	0.758	vesicle membrane
GO:0005654	0.746	nucleoplasm
GO:0030659	0.735	cytoplasmic vesicle membrane
GO:0030135	0.597	coated vesicle
GO:0030136	0.571	clathrin-coated vesicle
GO:0005905	0.483	clathrin-coated pit
GO:0005576	0.411	extracellular region
GO:0065010	0.346	extracellular membrane-bounded organelle
GO:0005730	0.341	nucleolus
GO:0005768	0.340	endosome
GO:0030665	0.338	clathrin-coated vesicle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]