StarFunc result for job id P98088

User Input

>input (1400 residues)
MSVGRRKLALLWALALALACTRHTGHAQDGSSESSYKHHPALSPIARGPSGVPLRGATVF
PSLRTIPVVRASNPAHNGRVCSTWGSFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNI
QLRRSQESAAPTLSRVLMKVDGVVIQLTKGSVLVNGHPVLLPFSQSGVLIQQSSSYTKVE
ARLGLVLMWNHDDSLLLELDTKYANKTCGLCGDFNGMPVVSELLSHNTKLTPMEFGNLQK
MDDPTDQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCED
TDLLSCVCHTLAEYSRQCTHAGGLPQDWRGPDFCPQKCPNNMQYHECRSPCADTCSNQEH
SRACEDHCVAGCFCPEGTVLDDIGQTGCVPVSKCACVYNGAAYAPGATYSTDCTNCTCSG
GRWSCQEVPCPGTCSVLGGAHFSTFDGKQYTVHGDCSYVLTKPCDSSAFTVLAELRRCGL
TDSETCLKSVTLSLDGAQTVVVIKASGEVFLNQIYTQLPISAANVTIFRPSTFFIIAQTS
LGLQLNLQLVPTMQLFMQLAPKLRGQTCGLCGNFNSIQADDFRTLSGVVEATAAAFFNTF
KTQAACPNIRNSFEDPCSLSVENEKYAQHWCSQLTDADGPFGRCHAAVKPGTYYSNCMFD
TCNCERSEDCLCAALSSYVHACAAKGVQLGGWRDGVCTKPMTTCPKSMTYHYHVSTCQPT
CRSLSEGDITCSVGFIPVDGCICPKGTFLDDTGKCVQASNCPCYHRGSMIPNGESVHDSG
AICTCTHGKLSCIGGQAPAPVCAAPMVFFDCRNATPGDTGAGCQKSCHTLDMTCYSPQCV
PGCVCPDGLVADGEGGCITAEDCPCVHNEASYRAGQTIRVGCNTCTCDSRMWRCTDDPCL
ATCAVYGDGHYLTFDGQSYSFNGDCEYTLVQNHCGGKDSTQDSFRVVTENVPCGTTGTTC
SKAIKIFLGGFELKLSHGKVEVIGTDESQEVPYTIRQMGIYLVVDTDIGLVLLWDKKTSI
FINLSPEFKGRVCGLCGNFDDIAVNDFATRSRSVVGDVLEFGNSWKLSPSCPDALAPKDP
CTANPFRKSWAQKQCSILHGPTFAACHAHVEPARYYEACVNDACACDSGGDCECFCTAVA
AYAQACHEVGLCVSWRTPSICPLFCDYYNPEGQCEWHYQPCGVPCLRTCRNPRGDCLRDV
RGLEGCYPKCPPEAPIFDEDKMQCVATCPTPPLPPRCHVHGKSYRPGAVVPSDKNCQSCL
CTERGVECTYKAEACVCTYNGQRFHPGDVIYHTTDGTGGCISARCGANGTIERRVYPCSP
TTPVPPTTFSFSTPPLVVSSTHTPSNGPSSAHTGPPSSAWPTTAGTSPRTRLPTASASLP
PVCGEKCLWSPWMDVSRPGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K1Y4	0.782	0.992	0.000	1103	0.616	0.782	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	AFDB:Q6W4X9	0.759	0.442	0.000	2439	0.358	0.205	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
3	AFDB:Q80Z19	0.467	0.250	0.000	2680	0.447	0.234	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
4	AFDB:Q98UI9	0.783	0.526	0.000	2108	0.409	0.272	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
5	AFDB:F1NBL0	0.755	0.888	5.121E-102	1185	0.319	0.376	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
6	AFDB:Q3ZCN5	0.423	0.264	2.920E-86	2332	0.291	0.175	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
7	AFDB:A0A286YAF1	0.392	0.267	2.705E-83	2146	0.269	0.175	A0A286YAF1.pdb.gz
8	AFDB:Q28983	0.230	0.133	1.336E-68	2476	0.246	0.139	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
9	AFDB:O08523	0.221	0.149	3.616E-63	2155	0.216	0.140	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
10	AFDB:E9Q0B5	0.229	0.127	2.770E-61	2583	0.241	0.131	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
11	PDB:6z3mc	0.085	0.656	5.014E-4	158	0.015	0.133	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:7d5sBE	0.053	0.072	7.677E-2	865	0.045	0.073	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:6iyyA	0.049	0.139	1.163E-1	312	0.019	0.083	6iyyA.pdb.gz
14	PDB:5jozA	0.043	0.082	1.276E-1	507	0.040	0.110	5jozA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
15	PDB:7lpsA	0.054	0.077	1.336E-1	781	0.041	0.074	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
16	PDB:4ga9A	0.045	0.238	1.399E-1	134	0.016	0.172	4ga9A.pdb.gz	Gal-1 structure analysis
17	PDB:7mq8LT	0.034	0.052	1.399E-1	869	0.011	0.017	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6lqsBE	0.046	0.067	2.024E-1	823	0.044	0.075	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
19	PDB:2hyeA	0.050	0.059	2.219E-1	1140	0.041	0.050	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
20	PDB:5hxbY	0.075	0.086	2.324E-1	1080	0.080	0.104	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1Y4	2124	3586	0.739	0.288	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	A0A0G2K8X5	2126	3922	0.739	0.264	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
3	E7F9Z1	713	2812	0.306	0.152	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
4	E9PWB6	2137	2751	0.737	0.375	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
5	E9Q5I3	1696	4800	0.558	0.163	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
6	E9QAQ8	2148	3455	0.737	0.299	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
7	F1NBL0	818	1185	0.320	0.378	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
8	P04275	676	2813	0.311	0.155	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
9	P98088	3034	5654	1.000	0.248	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
10	Q02817	1284	5179	0.451	0.122	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
11	Q62635	1253	1513	0.436	0.403	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
12	Q6PZE0	737	7524	0.304	0.056	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
13	Q6W4X9	831	2439	0.337	0.194	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
14	Q7Z5P9	734	8384	0.308	0.051	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
15	Q80Z19	1247	2680	0.442	0.231	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
16	Q8BYW0	1668	1477	0.567	0.538	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
17	Q8CIZ8	684	2813	0.305	0.152	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
18	Q8K1G6	1691	4782	0.556	0.163	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
19	Q98UI9	1175	2108	0.409	0.272	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
20	Q9ESP3	2129	1851	0.738	0.558	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	8e-47	168.8	C8 domain
2	PF01826 TIL	3.7e-16	70.4	Trypsin Inhibitor like cysteine rich domain
3	PF00093 VWC	0.017	26.8	von Willebrand factor type C domain
4	PF00094 VWD	6.3e-90	310.9	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485659

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484824	0.987	Mucin-1
2	9606.ENSP00000381008	0.984	Mucin-16
3	9606.ENSP00000407422	0.980	Mucin-7
4	9606.ENSP00000485028	0.974	Mucin-13
5	9606.ENSP00000416753	0.973	Mucin-15
6	9606.ENSP00000314500	0.972	Polypeptide N-acetylgalactosaminyltransferase 14
7	9606.ENSP00000441929	0.971	Mucin-12
8	9606.ENSP00000302716	0.969	Mucin-17
9	9606.ENSP00000368771	0.968	Mucin-3A
10	9606.ENSP00000414350	0.968	Mucin-20
11	9606.ENSP00000365473	0.959	Mucin-21
12	9606.ENSP00000364150	0.957	Polypeptide N-acetylgalactosaminyltransferase 12
13	9606.ENSP00000291527	0.953	Trefoil factor 1
14	9606.ENSP00000417498	0.945	Mucin-4
15	9606.ENSP00000341551	0.944	Mothers against decapentaplegic homolog 4
16	9606.ENSP00000236709	0.942	Alpha-1,4-N-acetylglucosaminyltransferase
17	9606.ENSP00000355632	0.941	Polypeptide N-acetylgalactosaminyltransferase 2
18	9606.ENSP00000389176	0.941	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
19	9606.ENSP00000436812	0.941	Mucin-5B
20	9606.ENSP00000376465	0.938	Polypeptide N-acetylgalactosaminyltransferase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046790	0.304	virion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.895	response to stimulus
GO:0009987	0.867	cellular process
GO:0048017	0.702	inositol lipid-mediated signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.989	extracellular space
GO:0005737	0.937	cytoplasm
GO:0043231	0.849	intracellular membrane-bounded organelle
GO:0070013	0.825	intracellular organelle lumen
GO:0012505	0.794	endomembrane system
GO:0016020	0.536	membrane
GO:0071944	0.444	cell periphery
GO:0005794	0.361	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]