StarFunc result for job id P98095

User Input

>input (1184 residues)
MVLLWEPAGAWLALGLALALGPSVAAAAPRQDCTGVECPPLENCIEEALEPGACCATCVQ
QGCACEGYQYYDCLQGGFVRGRVPAGQSYFVDFGSTECSCPPGGGKISCQFMLCPELPPN
CIEAVVVADSCPQCGQVGCVHAGHKYAAGHTVHLPPCRACHCPDAGGELICYQLPGCHGN
FSDAEEGDPERHYEDPYSYDQEVAEVEAATALGGEVQAGAVQAGAGGPPAALGGGSQPLS
TIQAPPWPAVLPRPTAAAALGPPAPVQAKARRVTEDSEEEEEEEEEREEMAVTEQLAAGG
HRGLDGLPTTAPAGPSLPIQEERAEAGARAEAGARPEENLILDAQATSRSTGPEGVTHAP
SLGKAALVPTQAVPGSPRDPVKPSPHNILSTSLPDAAWIPPTREVPRKPQVLPHSHVEED
TDPNSVHSIPRSSPEGSTKDLIETCCAAGQQWAIDNDECLEIPESGTEDNVCRTAQRHCC
VSYLQEKSCMAGVLGAKEGETCGAEDNDSCGISLYKQCCDCCGLGLRVRAEGQSCESNPN
LGYPCNHVMLSCCEGEEPLIVPEVRRPPEPAAAPRRVSEAEMAGREALSLGTEAELPNSL
PGDDQDECLLLPGELCQHLCINTVGSYHCACFPGFSLQDDGRTCRPEGHPPQPEAPQEPA
LKSEFSQVASNTIPLPLPQPNTCKDNGPCKQVCSTVGGSAICSCFPGYAIMADGVSCEDI
NECVTDLHTCSRGEHCVNTLGSFHCYKALTCEPGYALKDGECEDVDECAMGTHTCQPGFL
CQNTKGSFYCQARQRCMDGFLQDPEGNCVDINECTSLSEPCRPGFSCINTVGSYTCQRNP
LICARGYHASDDGTKCVDVNECETGVHRCGEGQVCHNLPGSYRCDCKAGFQRDAFGRGCI
DVNECWASPGRLCQHTCENTLGSYRCSCASGFLLAADGKRCEDVNECEAQRCSQECANIY
GSYQCYCRQGYQLAEDGHTCTDIDECAQGAGILCTFRCLNVPGSYQCACPEQGYTMTANG
RSCKDVDECALGTHNCSEAETCHNIQGSFRCLRFECPPNYVQVSKTKCERTTCHDFLECQ
NSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGDTIALNIIKGNEEGYFGTRRLNAYTG
VVYLQRAVLEPRDFALDVEMKLWRQGSVTTFLAKMHIFFTTFAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1SPG5	0.372	0.362	0.000	1221	0.824	0.799	F1SPG5.pdb.gz	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
2	AFDB:P98095	1.000	1.000	0.000	1184	1.000	1.000	P98095.pdb.gz	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
3	PDB:7q3nU	0.045	0.125	2.985E-7	292	0.041	0.168	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
4	AFDB:E9Q7X6	0.052	0.048	5.964E-6	1337	0.152	0.135	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
5	AFDB:Q9ULI3	0.052	0.046	1.369E-5	1381	0.131	0.112	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
6	AFDB:Q6R8J2	0.051	0.060	1.709E-5	977	0.116	0.140	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
7	AFDB:A1Z6W9	0.054	0.048	4.123E-3	1363	0.149	0.129	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
8	PDB:6velC	0.065	0.307	2.291E-2	209	0.016	0.091	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
9	PDB:4ys4A	0.054	0.189	2.560E-2	261	0.009	0.042	4ys4A.pdb.gz	The Structure of Plasmodium falciparum Blood-Stage 6-Cys Protein Pf41 Reveals an Unexpected Intra-Domain Insertion Required for Pf12 Coordination.
10	AFDB:Q8CHH5	0.041	0.045	3.203E-2	1074	0.096	0.106	Q8CHH5.pdb.gz	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
11	AFDB:Q86PA6	0.040	0.052	3.783E-2	744	0.093	0.148	Q86PA6.pdb.gz	Q86PA6_DROME LD29371p OS=Drosophila melanogaster OX=7227 GN=da PE=1 SV=1
12	AFDB:A0A2R8QK78	0.060	0.047	3.998E-2	1570	0.101	0.076	A0A2R8QK78.pdb.gz
13	PDB:3zmrA	0.049	0.110	6.941E-2	469	0.007	0.017	3zmrA.pdb.gz	A Discrete Genetic Locus Confers Xyloglucan Metabolism in Select Human Gut Bacteroidetes
14	PDB:3o3uN	0.050	0.088	7.336E-2	580	0.017	0.034	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
15	PDB:4lk4A	0.040	0.130	7.336E-2	326	0.007	0.025	4lk4A.pdb.gz
16	AFDB:Q0J235	0.035	0.068	7.774E-2	532	0.072	0.160	Q0J235.pdb.gz	ROLL9_ORYSJ Probable transcription factor RL9 OS=Oryza sativa subsp. japonica OX=39947 GN=RL9 PE=2 SV=2
17	PDB:1kiuB	0.060	0.195	8.663E-2	279	0.008	0.032	1kiuB.pdb.gz	Structural basis of tropism of Escherichia coli to the bladder during urinary tract infection.
18	PDB:7sqcO1	0.056	0.092	9.678E-2	673	0.008	0.013	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:2jtyA	0.060	0.261	1.023E-1	184	0.014	0.092	2jtyA.pdb.gz
20	PDB:4jmxA	0.032	0.119	1.143E-1	216	0.004	0.023	4jmxA.pdb.gz	Structures of free and inhibited forms of the L,D-transpeptidase LdtMt1 from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1WC21	0.0	597	685	0.240	0.415	B1WC21_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=2 SV=1
2	D3ZQ25	0.0	549	655	0.223	0.403	D3ZQ25_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=3 SV=2
3	F1SPG5	0.0	1894	1221	0.828	0.803	F1SPG5_PIG Fibulin 2 OS=Sus scrofa OX=9823 GN=FBLN2 PE=1 SV=3
4	P37889	0.0	1878	1221	0.813	0.789	FBLN2_MOUSE Fibulin-2 OS=Mus musculus OX=10090 GN=Fbln2 PE=1 SV=2
5	P98095	0.0	2407	1184	1.000	1.000	FBLN2_HUMAN Fibulin-2 OS=Homo sapiens OX=9606 GN=FBLN2 PE=1 SV=2
6	Q8NBH6	1.90e-159	491	638	0.218	0.404	Q8NBH6_HUMAN Fibulin-1 OS=Homo sapiens OX=9606 PE=2 SV=1
7	P23142	1.53e-158	491	703	0.218	0.367	FBLN1_HUMAN Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4
8	Q08879	1.99e-156	486	705	0.214	0.359	FBLN1_MOUSE Fibulin-1 OS=Mus musculus OX=10090 GN=Fbln1 PE=1 SV=2
9	A0A0G2JY81	9.37e-153	476	695	0.213	0.363	A0A0G2JY81_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=1 SV=1
10	O42182	1.31e-136	432	681	0.196	0.341	FBLN1_DANRE Fibulin-1 OS=Danio rerio OX=7955 GN=fbln1 PE=2 SV=1
11	A0A8I6AAN5	8.26e-136	431	683	0.204	0.353	A0A8I6AAN5_RAT Fibulin-1 OS=Rattus norvegicus OX=10116 GN=Fbln1 PE=1 SV=1
12	O95967	5.44e-80	271	443	0.133	0.357	FBLN4_HUMAN EGF-containing fibulin-like extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=EFEMP2 PE=1 SV=3
13	O77469	1.43e-79	279	728	0.163	0.265	FBLN1_CAEEL Fibulin-1 OS=Caenorhabditis elegans OX=6239 GN=fbl-1 PE=1 SV=3
14	Q9WVJ9	8.37e-79	268	443	0.133	0.354	FBLN4_MOUSE EGF-containing fibulin-like extracellular matrix protein 2 OS=Mus musculus OX=10090 GN=Efemp2 PE=1 SV=1
15	Q9WVH9	2.34e-70	244	448	0.127	0.335	FBLN5_MOUSE Fibulin-5 OS=Mus musculus OX=10090 GN=Fbln5 PE=1 SV=1
16	Q9WVH8	6.73e-69	240	448	0.127	0.335	FBLN5_RAT Fibulin-5 OS=Rattus norvegicus OX=10116 GN=Fbln5 PE=2 SV=1
17	Q9UBX5	1.39e-66	234	448	0.123	0.326	FBLN5_HUMAN Fibulin-5 OS=Homo sapiens OX=9606 GN=FBLN5 PE=1 SV=1
18	Q96RW7	1.21e-63	241	5635	0.150	0.032	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
19	D3YXG0	1.72e-61	234	5634	0.151	0.032	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
20	Q8BPB5	1.51e-60	218	493	0.125	0.300	FBLN3_MOUSE EGF-containing fibulin-like extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Efemp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01821 ANATO	0.047	25.9	Anaphylotoxin-like domain
2	PF05432 BSP_II	5.2e+02	11.7	Bone sialoprotein II (BSP-II)
3	PF12662 cEGF	9.2e-55	193.4	Complement Clr-like EGF-like
4	PF00008 EGF	0.036	25.7	EGF-like domain
5	PF12947 EGF_3	3.5e-07	41.6	EGF domain
6	PF07645 EGF_CA	2.6e-74	256.5	Calcium-binding EGF domain
7	PF14670 FXa_inhibition	1.8e-20	84.3	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	19	17.3	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351807	0.957	Elastin
2	9606.ENSP00000363827	0.954	Basement membrane-specific heparan sulfate proteoglycan core protein
3	9606.ENSP00000346839	0.949	Fibronectin type III domain containing
4	9606.ENSP00000265077	0.904	Versican core protein
5	9606.ENSP00000422554	0.874	A disintegrin and metalloproteinase with thrombospondin motifs 12
6	9606.ENSP00000417498	0.844	Mucin-4
7	9606.ENSP00000364685	0.805	Microfibrillar-associated protein 2
8	9606.ENSP00000374309	0.790	Laminin subunit alpha-1
9	9606.ENSP00000352455	0.778	Microfibrillar-associated protein 5
10	9606.ENSP00000378957	0.778	Microfibril-associated glycoprotein 4
11	9606.ENSP00000373244	0.764	Chondroitin sulfate proteoglycan 5
12	9606.ENSP00000369816	0.754	Sex hormone-binding globulin
13	9606.ENSP00000264187	0.750	Nidogen-1
14	9606.ENSP00000347665	0.749	Collagen alpha-1(XVIII) chain
15	9606.ENSP00000257867	0.739	Extracellular glycoprotein lacritin
16	9606.ENSP00000309953	0.734	EGF containing fibulin extracellular matrix protein 2
17	9606.ENSP00000345008	0.733	Fibulin-5
18	9606.ENSP00000226218	0.730	Vitronectin
19	9606.ENSP00000378058	0.727	EGF-containing fibulin-like extracellular matrix protein 1
20	9606.ENSP00000325527	0.714	Fibrillin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005201	0.998	extracellular matrix structural constituent
GO:0005509	0.997	calcium ion binding
GO:0005102	0.619	signaling receptor binding
GO:0044877	0.530	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.966	regulation of cellular process
GO:0009987	0.942	cellular process
GO:0048522	0.842	positive regulation of cellular process
GO:0030155	0.801	regulation of cell adhesion
GO:0032501	0.699	multicellular organismal process
GO:0032502	0.631	developmental process
GO:0048856	0.569	anatomical structure development
GO:0007275	0.539	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	1.000	collagen-containing extracellular matrix
GO:0005576	0.987	extracellular region
GO:0043227	0.980	membrane-bounded organelle
GO:0031982	0.920	vesicle
GO:0043230	0.825	extracellular organelle
GO:0005615	0.802	extracellular space
GO:0065010	0.794	extracellular membrane-bounded organelle
GO:1903561	0.740	extracellular vesicle
GO:0005622	0.735	intracellular anatomical structure
GO:0005737	0.655	cytoplasm
GO:0043229	0.639	intracellular organelle
GO:0043231	0.566	intracellular membrane-bounded organelle
GO:0070013	0.460	intracellular organelle lumen
GO:0012505	0.402	endomembrane system
GO:0070062	0.327	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]