StarFunc result for job id P98155

User Input

>input (873 residues)
MGTSALWALWLLLALCWAPRESGATGTGRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVD
GSDEKNCVKKTCAESDFVCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISC
GAHSTQCIPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQDDCS
DGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLEQCGRQPVIHTKCP
ASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGI
RDCVDGSDEVNCKNVNQCLGPGKFKCRSGECIDISKVCNQEQDCRDWSDEPLKECHINEC
LVNNGGCSHICKDLVIGYECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCE
CSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDADIAA
QKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTIYWTDAASKTISVA
TLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTADIQ
WPNGITLDLIKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWI
DGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCL
PAPQINDHSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVPGGI
NVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMKSMNFDNPVYLKT
TEEDLSIDIGRHSASVGHTYPAISVVSTDDDLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZE75	0.661	0.610	0.000	953	0.520	0.476	D3ZE75.pdb.gz	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
2	AFDB:P01131	0.514	0.530	0.000	845	0.477	0.492	P01131.pdb.gz	LDLR_BOVIN Low-density lipoprotein receptor OS=Bos taurus OX=9913 GN=LDLR PE=1 SV=2
3	AFDB:P35951	0.623	0.630	0.000	862	0.472	0.478	P35951.pdb.gz	LDLR_MOUSE Low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Ldlr PE=1 SV=2
4	AFDB:P98155	1.000	1.000	0.000	873	1.000	1.000	P98155.pdb.gz	VLDLR_HUMAN Very low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=VLDLR PE=1 SV=1
5	AFDB:P98165	0.737	0.745	0.000	863	0.790	0.800	P98165.pdb.gz	VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1
6	AFDB:Q90W12	0.716	0.736	0.000	847	0.684	0.705	Q90W12.pdb.gz	Q90W12_ONCMY Vitellogenin receptor OS=Oncorhynchus mykiss OX=8022 GN=vtg receptor PE=2 SV=1
7	AFDB:Q98931	0.502	0.479	0.000	917	0.537	0.511	Q98931.pdb.gz	LRP8_CHICK Low-density lipoprotein receptor-related protein 8 OS=Gallus gallus OX=9031 GN=LRP8 PE=1 SV=1
8	AFDB:P35952	0.688	0.683	3.483E-104	879	0.477	0.473	P35952.pdb.gz	LDLR_RAT Low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Ldlr PE=1 SV=1
9	AFDB:E9QGD4	0.623	0.625	4.951E-104	870	0.467	0.469	E9QGD4.pdb.gz	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
10	AFDB:P01130	0.491	0.498	5.428E-104	860	0.477	0.484	P01130.pdb.gz	LDLR_HUMAN Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR PE=1 SV=1
11	PDB:1ri6A	0.228	0.531	6.383E-10	333	0.036	0.093	1ri6A.pdb.gz
12	PDB:2hqsA	0.269	0.542	6.751E-10	412	0.032	0.068	2hqsA.pdb.gz
13	PDB:4gn7A	0.236	0.644	4.052E-9	297	0.045	0.131	4gn7A.pdb.gz	Structural basis of the gamma-lactone-ring formation in ascorbic acid biosynthesis by the senescence marker protein-30/gluconolactonase
14	PDB:6bk8M	0.229	0.546	4.532E-9	326	0.039	0.104	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
15	PDB:5c2vB	0.227	0.517	5.669E-9	352	0.032	0.080	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
16	PDB:7mq8LT	0.226	0.227	1.313E-8	869	0.053	0.053	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8LU	0.236	0.437	2.299E-8	445	0.030	0.058	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:5k1aF	0.212	0.297	2.432E-8	600	0.036	0.052	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
19	PDB:7mq8LO	0.208	0.214	3.042E-8	848	0.029	0.029	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6zwmC	0.219	0.535	3.217E-8	319	0.027	0.075	6zwmC.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KGZ9	615	834	0.389	0.408	A0A0B4KGZ9_DROME Lipophorin receptor 2, isoform I OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1
2	A0A0B4KH38	616	862	0.394	0.399	A0A0B4KH38_DROME Lipophorin receptor 2, isoform H OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1
3	A0A8I5ZTA7	792	958	0.489	0.446	A0A8I5ZTA7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
4	A0A8I5ZVL7	609	790	0.370	0.409	A0A8I5ZVL7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
5	A0A8I6A6L0	624	729	0.376	0.450	A0A8I6A6L0_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
6	A0A8I6AE51	640	697	0.386	0.484	A0A8I6AE51_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
7	A0A8I6ALZ7	800	972	0.493	0.442	A0A8I6ALZ7_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
8	A0A8I6GFL9	804	913	0.493	0.471	A0A8I6GFL9_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
9	A0A8I6GH61	724	873	0.426	0.426	A0A8I6GH61_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=1
10	A8JRC4	647	1029	0.415	0.352	A8JRC4_DROME Lipophorin receptor 2, isoform C OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1
11	A8JRC7	634	1063	0.417	0.342	A8JRC7_DROME Lipophorin receptor 2, isoform G OS=Drosophila melanogaster OX=7227 GN=LpR2 PE=4 SV=1
12	A8JRD0	630	1076	0.423	0.343	A8JRD0_DROME Lipophorin receptor 1, isoform K OS=Drosophila melanogaster OX=7227 GN=LpR1 PE=4 SV=2
13	A8JRD2	590	887	0.394	0.388	A8JRD2_DROME Lipophorin receptor 1, isoform S OS=Drosophila melanogaster OX=7227 GN=LpR1 PE=4 SV=3
14	D3ZE75	869	999	0.518	0.452	D3ZE75_RAT LDL receptor related protein 8 OS=Rattus norvegicus OX=10116 GN=Lrp8 PE=4 SV=4
15	E9QGD4	832	870	0.470	0.471	E9QGD4_DANRE Low density lipoprotein receptor a OS=Danio rerio OX=7955 GN=ldlr PE=4 SV=1
16	H0Z4W1	1414	849	0.786	0.808	H0Z4W1_TAEGU Very low density lipoprotein receptor OS=Taeniopygia guttata OX=59729 GN=VLDLR PE=4 SV=2
17	P01130	858	860	0.481	0.488	LDLR_HUMAN Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR PE=1 SV=1
18	P01131	818	845	0.479	0.495	LDLR_BOVIN Low-density lipoprotein receptor OS=Bos taurus OX=9913 GN=LDLR PE=1 SV=2
19	P35951	830	862	0.470	0.476	LDLR_MOUSE Low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Ldlr PE=1 SV=2
20	P35952	832	879	0.483	0.480	LDLR_RAT Low-density lipoprotein receptor OS=Rattus norvegicus OX=10116 GN=Ldlr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	0.026	25.7	Complement Clr-like EGF-like
2	PF13194 DUF4010	1.1e+02	13.8	Domain of unknown function (DUF4010)
3	PF00008 EGF	3.8	19.2	EGF-like domain
4	PF07645 EGF_CA	0.0003	32.2	Calcium-binding EGF domain
5	PF14670 FXa_inhibition	2.1e-13	61.7	Coagulation Factor Xa inhibitory site
6	PF00057 Ldl_recept_a	1.2e-99	337.5	Low-density lipoprotein receptor domain class A
7	PF00058 Ldl_recept_b	6.1e-63	220.4	Low-density lipoprotein receptor repeat class B
8	PF08450 SGL	0.21	22.7	SMP-30/Gluconolactonase/LRE-like region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392423	0.999	Reelin
2	9606.ENSP00000252486	0.997	Apolipoprotein E
3	9606.ENSP00000360280	0.995	Disabled homolog 1
4	9606.ENSP00000223095	0.991	Plasminogen activator inhibitor 1
5	9606.ENSP00000421922	0.991	Alpha-2-macroglobulin receptor-associated protein
6	9606.ENSP00000380378	0.977	Platelet-activating factor acetylhydrolase IB subunit alpha
7	9606.ENSP00000349298	0.974	E3 ubiquitin-protein ligase MYLIP
8	9606.ENSP00000303208	0.961	Proprotein convertase subtilisin/kexin type 9
9	9606.ENSP00000346671	0.948	Tyrosine-protein kinase Fyn
10	9606.ENSP00000444935	0.946	Platelet-activating factor acetylhydrolase IB subunit gamma
11	9606.ENSP00000346300	0.938	Crk-like protein
12	9606.ENSP00000435289	0.938	Platelet-activating factor acetylhydrolase IB subunit beta
13	9606.ENSP00000361263	0.935	Rap guanine nucleotide exchange factor 1
14	9606.ENSP00000451828	0.934	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000361850	0.933	Urokinase-type plasminogen activator
16	9606.ENSP00000303634	0.932	Low-density lipoprotein receptor-related protein 8
17	9606.ENSP00000007722	0.931	Integrin alpha-3
18	9606.ENSP00000477707	0.923	Oxysterols receptor LXR-alpha
19	9606.ENSP00000253727	0.922	Oxysterols receptor LXR-beta
20	9606.ENSP00000296755	0.920	Microtubule-associated protein 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030228	0.999	lipoprotein particle receptor activity
GO:0005041	0.938	low-density lipoprotein particle receptor activity
GO:0071814	0.937	protein-lipid complex binding
GO:0071813	0.929	lipoprotein particle binding
GO:0034185	0.594	apolipoprotein binding
GO:0005102	0.433	signaling receptor binding
GO:0048306	0.396	calcium-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0065007	0.984	biological regulation
GO:0050896	0.980	response to stimulus
GO:0032501	0.980	multicellular organismal process
GO:0050789	0.971	regulation of biological process
GO:0048856	0.917	anatomical structure development
GO:0050794	0.901	regulation of cellular process
GO:0007275	0.887	multicellular organism development
GO:0048731	0.805	system development
GO:0007399	0.728	nervous system development
GO:0051716	0.686	cellular response to stimulus
GO:0048518	0.638	positive regulation of biological process
GO:0048522	0.488	positive regulation of cellular process
GO:0019222	0.468	regulation of metabolic process
GO:0007154	0.449	cell communication
GO:0023052	0.446	signaling
GO:0051179	0.444	localization
GO:0008152	0.434	metabolic process
GO:0048513	0.408	animal organ development
GO:0007165	0.397	signal transduction
GO:0051234	0.386	establishment of localization
GO:0071840	0.383	cellular component organization or biogenesis
GO:0006810	0.378	transport
GO:0044238	0.376	primary metabolic process
GO:0080090	0.371	regulation of primary metabolic process
GO:0031323	0.359	regulation of cellular metabolic process
GO:0060255	0.355	regulation of macromolecule metabolic process
GO:0071704	0.351	organic substance metabolic process
GO:0051171	0.350	regulation of nitrogen compound metabolic process
GO:0048519	0.349	negative regulation of biological process
GO:0016043	0.344	cellular component organization
GO:0009893	0.312	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.982	cytoplasm
GO:0005576	0.980	extracellular region
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0005886	0.976	plasma membrane
GO:0032991	0.938	protein-containing complex
GO:0005615	0.932	extracellular space
GO:0012505	0.894	endomembrane system
GO:0031982	0.884	vesicle
GO:0031090	0.820	organelle membrane
GO:0097708	0.697	intracellular vesicle
GO:0031410	0.687	cytoplasmic vesicle
GO:0098588	0.554	bounding membrane of organelle
GO:0005768	0.524	endosome
GO:0005634	0.426	nucleus
GO:0009986	0.422	cell surface
GO:0005773	0.355	vacuole
GO:0065010	0.323	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]