StarFunc result for job id P98160

User Input

>input (1400 residues)
MGWRAAGALLLALLLHGRLLAVTHGLRAYDGLSLPEDIETVTASQMRWTHSYLSDDEDML
ADSISGDDLGSGDLGSGDFQMVYFRALVNFTRSIEYSPQLEDAGSREFREVSEAVVDTLE
SEYLKIPGDQVVSVVFIKELDGWVFVELDVGSEGNADGAQIQEMLLRVISSGSVASYVTS
PQGFQFRRLGTVPQFPRACTEAEFACHSYNECVALEYRCDRRPDCRDMSDELNCEEPVLG
ISPTFSLLVETTSLPPRPETTIMRQPPVTHAPQPLLPGSVRPLPCGPQEAACRNGHCIPR
DYLCDGQEDCEDGSDELDCGPPPPCEPNEFPCGNGHCALKLWRCDGDFDCEDRTDEANCP
TKRPEEVCGPTQFRCVSTNMCIPASFHCDEESDCPDRSDEFGCMPPQVVTPPRESIQASR
GQTVTFTCVAIGVPTPIINWRLNWGHIPSHPRVTVTSEGGRGTLIIRDVKESDQGAYTCE
AMNARGMVFGIPDGVLELVPQRGPCPDGHFYLEHSAACLPCFCFGITSVCQSTRRFRDQI
RLRFDQPDDFKGVNVTMPAQPGTPPLSSTQLQIDPSLHEFQLVDLSRRFLVHDSFWALPE
QFLGNKVDSYGGSLRYNVRYELARGMLEPVQRPDVVLMGAGYRLLSRGHTPTQPGALNQR
QVQFSEEHWVHESGRPVQRAELLQVLQSLEAVLIQTVYNTKMASVGLSDIAMDTTVTHAT
SHGRAHSVEECRCPIGYSGLSCESCDAHFTRVPGGPYLGTCSGCNCNGHASSCDPVYGHC
LNCQHNTEGPQCNKCKAGFFGDAMKATATSCRPCPCPYIDASRRFSDTCFLDTDGQATCD
ACAPGYTGRRCESCAPGYEGNPIQPGGKCRPVNQEIVRCDERGSMGTSGEACRCKNNVVG
RLCNECADGSFHLSTRNPDGCLKCFCMGVSRHCTSSSWSRAQLHGASEEPGHFSLTNAAS
THTTNEGIFSPTPGELGFSSFHRLLSGPYFWSLPSRFLGDKVTSYGGELRFTVTQRSQPG
STPLHGQPLVVLQGNNIILEHHVAQEPSPGQPSTFIVPFREQAWQRPDGQPATREHLLMA
LAGIDTLLIRASYAQQPAESRVSGISMDVAVPEETGQDPALEVEQCSCPPGYRGPSCQDC
DTGYTRTPSGLYLGTCERCSCHGHSEACEPETGACQGCQHHTEGPRCEQCQPGYYGDAQR
GTPQDCQLCPCYGDPAAGQAAHTCFLDTDGHPTCDACSPGHSGRHCERCAPGYYGNPSQG
QPCQRDSQVPGPIGCNCDPQGSVSSQCDAAGQCQCKAQVEGLTCSHCRPHHFHLSASNPD
GCLPCFCMGITQQCASSAYTRHLISTHFAPGDFQGFALVNPQRNSRLTGEFTVEPVPEGA
QLSFGNFAQLGHESFYWQLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LTJ5	0.334	0.211	0.000	2449	0.850	0.486	F1LTJ5.pdb.gz	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
2	AFDB:A0A0G2KI51	0.250	0.408	5.515E-55	845	0.161	0.266	A0A0G2KI51.pdb.gz
3	AFDB:Q1LVF0	0.211	0.189	3.639E-49	1593	0.161	0.141	Q1LVF0.pdb.gz	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
4	AFDB:P11047	0.220	0.194	8.549E-49	1609	0.167	0.145	P11047.pdb.gz	LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3
5	AFDB:P15215	0.214	0.187	6.809E-47	1639	0.158	0.135	P15215.pdb.gz	LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=LanB2 PE=2 SV=2
6	AFDB:F1QPJ1	0.187	0.164	2.089E-46	1643	0.165	0.141	F1QPJ1.pdb.gz	F1QPJ1_DANRE Laminin subunit gamma-3 OS=Danio rerio OX=7955 GN=lamc3 PE=4 SV=1
7	AFDB:Q9R0B6	0.170	0.153	2.587E-46	1581	0.174	0.154	Q9R0B6.pdb.gz	LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus OX=10090 GN=Lamc3 PE=1 SV=2
8	AFDB:Q18823	0.208	0.183	2.060E-44	1633	0.164	0.141	Q18823.pdb.gz	LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans OX=6239 GN=lam-2 PE=1 SV=3
9	AFDB:P98165	0.047	0.070	4.755E-11	863	0.061	0.098	P98165.pdb.gz	VLDLR_CHICK Very low-density lipoprotein receptor OS=Gallus gallus OX=9031 GN=VLDLR PE=1 SV=1
10	AFDB:P25304	0.088	0.069	7.688E-11	1959	0.093	0.066	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
11	PDB:1aqkL	0.066	0.362	4.998E-7	216	0.026	0.167	1aqkL.pdb.gz
12	PDB:4aizA	0.056	0.642	1.800E-6	107	0.018	0.234	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
13	PDB:4fqqL	0.069	0.360	2.350E-6	213	0.026	0.169	4fqqL.pdb.gz
14	PDB:5ir3A	0.061	0.639	2.759E-6	111	0.017	0.216	5ir3A.pdb.gz
15	PDB:6vpyL	0.058	0.359	2.759E-6	209	0.024	0.163	6vpyL.pdb.gz
16	PDB:6feyB	0.067	0.425	3.603E-6	207	0.017	0.116	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
17	PDB:2cd0A	0.062	0.639	4.008E-6	111	0.017	0.216	2cd0A.pdb.gz
18	PDB:1cd0A	0.061	0.632	4.460E-6	111	0.017	0.216	1cd0A.pdb.gz
19	PDB:1a8jL	0.070	0.377	4.963E-6	216	0.028	0.181	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
20	PDB:4o5lL	0.069	0.369	5.522E-6	215	0.026	0.167	4o5lL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A023GRW4	613	3989	0.268	0.094	A0A023GRW4_DROME Terribly reduced optic lobes, isoform AZ OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=1
2	A0A8I6A2S5	2389	4402	0.851	0.271	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
3	A0A8I6ASH2	2400	4387	0.851	0.271	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
4	E1JJC0	612	4411	0.268	0.085	E1JJC0_DROME Terribly reduced optic lobes, isoform AH OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3
5	F1LTJ5	2357	2438	0.838	0.481	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
6	M9NDL5	612	4434	0.268	0.085	M9NDL5_DROME Terribly reduced optic lobes, isoform AF OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
7	M9NDM1	613	3806	0.268	0.099	M9NDM1_DROME Terribly reduced optic lobes, isoform AP OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
8	M9NE56	611	4176	0.268	0.090	M9NE56_DROME Terribly reduced optic lobes, isoform AK OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=1
9	M9NE61	613	4150	0.268	0.090	M9NE61_DROME Terribly reduced optic lobes, isoform AR OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
10	M9NES6	613	4451	0.268	0.084	M9NES6_DROME Terribly reduced optic lobes, isoform AU OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
11	M9NET2	615	3897	0.268	0.096	M9NET2_DROME Terribly reduced optic lobes, isoform AI OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
12	M9NFR6	613	3833	0.268	0.098	M9NFR6_DROME Terribly reduced optic lobes, isoform AY OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
13	M9NFS1	613	4299	0.268	0.087	M9NFS1_DROME Terribly reduced optic lobes, isoform AQ OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
14	M9NGK3	614	3728	0.268	0.101	M9NGK3_DROME Terribly reduced optic lobes, isoform AL OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
15	M9NGL3	613	3967	0.268	0.095	M9NGL3_DROME Terribly reduced optic lobes, isoform AM OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=2
16	P98160	2917	4391	1.000	0.319	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
17	Q05793	2457	3707	0.856	0.323	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
18	Q8IRV7	612	3105	0.268	0.121	Q8IRV7_DROME Terribly reduced optic lobes, isoform AG OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3
19	Q8IRV8	613	3887	0.268	0.096	Q8IRV8_DROME Terribly reduced optic lobes, isoform AO OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3
20	Q8IRV9	613	4007	0.268	0.094	Q8IRV9_DROME Terribly reduced optic lobes, isoform AW OS=Drosophila melanogaster OX=7227 GN=trol PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.4e-13	61.3	Immunoglobulin I-set domain
2	PF00047 ig	0.0004	31.8	Immunoglobulin domain
3	PF13895 Ig_2	0.00057	31.5	Immunoglobulin domain
4	PF13927 Ig_3	4.2e-13	61.0	Immunoglobulin domain
5	PF00052 Laminin_B	2.4e-78	272.0	Laminin B (Domain IV)
6	PF00053 Laminin_EGF	7.2e-40	146.2	Laminin EGF domain
7	PF00057 Ldl_recept_a	2.7e-33	125.2	Low-density lipoprotein receptor domain class A
8	PF07686 V-set	0.26	22.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363827

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264187	0.999	Nidogen-1
2	9606.ENSP00000442600	0.999	Dystroglycan
3	9606.ENSP00000264498	0.997	Fibroblast growth factor 2
4	9606.ENSP00000053867	0.992	Granulins
5	9606.ENSP00000216286	0.992	Nidogen-2
6	9606.ENSP00000346839	0.991	Fibronectin type III domain containing
7	9606.ENSP00000052754	0.985	Decorin
8	9606.ENSP00000327336	0.982	Biglycan
9	9606.ENSP00000358045	0.974	Extracellular matrix protein 1
10	9606.ENSP00000373298	0.974	Acetylcholinesterase collagenic tail peptide
11	9606.ENSP00000367446	0.967	Exostosin-1
12	9606.ENSP00000379350	0.962	Integrin beta-1
13	9606.ENSP00000305714	0.960	Bone morphogenetic protein 1
14	9606.ENSP00000478570	0.957	Vascular endothelial growth factor A
15	9606.ENSP00000261797	0.956	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
16	9606.ENSP00000261858	0.955	D-glucuronyl C5-epimerase
17	9606.ENSP00000384169	0.954	Fibulin-2
18	9606.ENSP00000379032	0.953	Exostosin-2
19	9606.ENSP00000308208	0.952	Matrix metalloproteinase-14
20	9606.ENSP00000331210	0.952	Brevican core protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	0.927	protein binding
GO:0005518	0.926	collagen binding
GO:0070052	0.547	collagen V binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.962	cellular process
GO:0032501	0.955	multicellular organismal process
GO:0048856	0.950	anatomical structure development
GO:0065007	0.934	biological regulation
GO:0050789	0.924	regulation of biological process
GO:0007275	0.894	multicellular organism development
GO:0050794	0.852	regulation of cellular process
GO:0050896	0.782	response to stimulus
GO:0048519	0.750	negative regulation of biological process
GO:0048513	0.708	animal organ development
GO:0044703	0.703	multi-organism reproductive process
GO:0042127	0.692	regulation of cell population proliferation
GO:0048523	0.681	negative regulation of cellular process
GO:0048518	0.670	positive regulation of biological process
GO:0023052	0.610	signaling
GO:0048522	0.599	positive regulation of cellular process
GO:0007154	0.515	cell communication
GO:0051716	0.500	cellular response to stimulus
GO:0050678	0.466	regulation of epithelial cell proliferation
GO:0042221	0.447	response to chemical
GO:0001936	0.445	regulation of endothelial cell proliferation
GO:0007566	0.441	embryo implantation
GO:0007165	0.421	signal transduction
GO:0050679	0.414	positive regulation of epithelial cell proliferation
GO:0006950	0.402	response to stress
GO:0001938	0.395	positive regulation of endothelial cell proliferation
GO:0007224	0.382	smoothened signaling pathway
GO:0007162	0.377	negative regulation of cell adhesion
GO:0031100	0.376	animal organ regeneration
GO:0048731	0.348	system development
GO:0001666	0.347	response to hypoxia
GO:0009410	0.324	response to xenobiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	1.000	cell periphery
GO:0031012	0.992	extracellular matrix
GO:0062023	0.984	collagen-containing extracellular matrix
GO:0005604	0.434	basement membrane
GO:0005622	0.423	intracellular anatomical structure
GO:0043229	0.400	intracellular organelle
GO:0012505	0.386	endomembrane system
GO:0005737	0.333	cytoplasm
GO:0005576	0.329	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]