StarFunc result for job id P98161

User Input

>input (1400 residues)
MPPAAPARLALALGLGLWLGALAGGPGRGCGPCEPPCLCGPAPGAACRVNCSGRGLRTLG
PALRIPADATALDVSHNLLRALDVGLLANLSALAELDISNNKISTLEEGIFANLFNLSEI
NLSGNPFECDCGLAWLPRWAEEQQVRVVQPEAATCAGPGSLAGQPLLGIPLLDSGCGEEY
VACLPDNSSGTVAAVSFSAAHEGLLQPEACSAFCFSTGQGLAALSEQGWCLCGAAQPSSA
SFACLSLCSGPPPPPAPTCRGPTLLQHVFPASPGATLVGPHGPLASGQLAAFHIAAPLPV
TATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEAAPAALE
LVCPSSVQSDESLDLSIQNRGGSGLEAAYSIVALGEEPARAVHPLCPSDTEIFPGNGHCY
RLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRFLVSRVTRSLDVWIGFSTVQGVEVGP
APQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTDLCSAPHSYVCELQPGGPVQD
AENLLVGAPSGDLQGPLTPLAQQDGLSAPHEPVEVMVFPGLRLSREAFLTTAEFGTQELR
RPAQLRLQVYRLLSTAGTPENGSEPESRSPDNRTQLAPACMPGGRWCPGANICLPLDASC
HPQACANGCTSGPGLPGAPYALWREFLFSVPAGPPAQYSVTLHGQDVLMLPGDLVGLQHD
AGPGALLHCSPAPGHPGPRAPYLSANASSWLPHLPAQLEGTWACPACALRLLAATEQLTV
LLGLRPNPGLRLPGRYEVRAEVGNGVSRHNLSCSFDVVSPVAGLRVIYPAPRDGRLYVPT
NGSALVLQVDSGANATATARWPGGSVSARFENVCPALVATFVPGCPWETNDTLFSVVALP
WLSEGEHVVDVVVENSASRANLSLRVTAEEPICGLRATPSPEARVLQGVLVRYSPVVEAG
SDMVFRWTINDKQSLTFQNVVFNVIYQSAAVFKLSLTASNHVSNVTVNYNVTVERMNRMQ
GLQVSTVPAVLSPNATLALTAGVLVDSAVEVAFLWTFGDGEQALHQFQPPYNESFPVPDP
SVAQVLVEHNVMHTYAAPGEYLLTVLASNAFENLTQQVPVSVRASLPSVAVGVSDGVLVA
GRPVTFYPHPLPSPGGVLYTWDFGDGSPVLTQSQPAANHTYASRGTYHVRLEVNNTVSGA
AAQADVRVFEELRGLSVDMSLAVEQGAPVVVSAAVQTGDNITWTFDMGDGTVLSGPEATV
EHVYLRAQNCTVTVGAASPAGHLARSLHVLVFVLEVLRVEPAACIPTQPDARLTAYVTGN
PAHYLFDWTFGDGSSNTTVRGCPTVTHNFTRSGTFPLALVLSSRVNRAHYFTSICVEPEV
GNVTLQPERQFVQLGDEAWL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7LCJ3	0.091	0.075	1.863E-24	1730	0.130	0.105	A7LCJ3.pdb.gz	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
2	AFDB:F1NY98	0.118	0.090	2.366E-24	2034	0.099	0.068	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3
3	AFDB:Q62230	0.100	0.089	1.321E-23	1695	0.104	0.086	Q62230.pdb.gz	SN_MOUSE Sialoadhesin OS=Mus musculus OX=10090 GN=Siglec1 PE=1 SV=2
4	AFDB:Q4VA61	0.120	0.093	3.777E-23	2053	0.099	0.067	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
5	AFDB:A0A2R8QL08	0.114	0.085	1.080E-22	2036	0.089	0.061	A0A2R8QL08.pdb.gz
6	AFDB:P23468	0.108	0.089	1.372E-22	1912	0.108	0.079	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
7	AFDB:P29534	0.162	0.256	2.108E-22	739	0.051	0.096	P29534.pdb.gz	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
8	AFDB:A0A0B4K6Z6	0.144	0.109	2.677E-22	2037	0.098	0.067	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
9	AFDB:C8VHB2	0.160	0.173	3.740E-22	1257	0.089	0.099	C8VHB2.pdb.gz	C8VHB2_EMENI Nuclear pore complex protein An-Pom152 (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03454 PE=4 SV=1
10	AFDB:Q9VS29	0.135	0.099	4.527E-22	2074	0.101	0.068	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
11	PDB:5a42A	0.081	0.074	6.401E-19	1597	0.084	0.074	5a42A.pdb.gz
12	PDB:1e07A	0.214	0.373	9.197E-17	642	0.048	0.104	1e07A.pdb.gz
13	PDB:7sqcO0	0.091	0.105	8.683E-16	1140	0.091	0.111	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:6h03A	0.086	0.096	6.771E-15	1223	0.059	0.068	6h03A.pdb.gz
15	PDB:4ziqA	0.079	0.077	2.977E-14	1450	0.063	0.061	4ziqA.pdb.gz
16	PDB:5oj2B	0.116	0.201	3.275E-14	692	0.064	0.129	5oj2B.pdb.gz
17	PDB:7q1yA	0.082	0.084	3.780E-14	1374	0.068	0.069	7q1yA.pdb.gz
18	PDB:7q5zA	0.085	0.087	2.435E-13	1344	0.061	0.064	7q5zA.pdb.gz
19	PDB:7nycA	0.088	0.081	1.178E-12	1542	0.061	0.056	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:4lnvA	0.081	0.086	1.569E-12	1276	0.055	0.060	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AC84	0.0	2040	4254	0.726	0.239	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
2	F1MAD3	0.0	2041	4292	0.726	0.237	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
3	O08852	0.0	2034	4293	0.726	0.237	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
4	P98161	0.0	2829	4303	1.000	0.325	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
5	Q9ERV0	0.0	2042	4283	0.727	0.238	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
6	Q5RKR3	3.89e-14	80.1	745	0.030	0.056	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
7	Q6UXK2	2.30e-13	77.4	745	0.029	0.055	ISLR2_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Homo sapiens OX=9606 GN=ISLR2 PE=1 SV=1
8	Q8IWK6	5.80e-13	76.6	1321	0.031	0.033	AGRA3_HUMAN Adhesion G protein-coupled receptor A3 OS=Homo sapiens OX=9606 GN=ADGRA3 PE=1 SV=2
9	E7FBY6	8.99e-12	72.8	1367	0.039	0.040	AGRA2_DANRE Adhesion G protein-coupled receptor A2 OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=2
10	A0A0U2ULT4	1.13e-11	72.4	1367	0.039	0.040	A0A0U2ULT4_DANRE Adhesion G protein-coupled receptor A2 precursor OS=Danio rerio OX=7955 GN=adgra2 PE=1 SV=1
11	P02750	1.91e-11	69.7	347	0.033	0.133	A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens OX=9606 GN=LRG1 PE=1 SV=2
12	Q7TT36	2.66e-11	71.2	1310	0.030	0.032	AGRA3_MOUSE Adhesion G protein-coupled receptor A3 OS=Mus musculus OX=10090 GN=Adgra3 PE=2 SV=3
13	O88280	3.54e-11	70.9	1523	0.031	0.028	SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus OX=10116 GN=Slit3 PE=2 SV=1
14	Q9WVB4	4.76e-11	70.5	1523	0.031	0.028	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2
15	O14498	5.94e-11	68.9	428	0.029	0.096	ISLR_HUMAN Immunoglobulin superfamily containing leucine-rich repeat protein OS=Homo sapiens OX=9606 GN=ISLR PE=2 SV=1
16	P24014	1.02e-10	69.3	1504	0.026	0.025	SLIT_DROME Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2
17	A1ZBX8	1.46e-10	68.6	808	0.039	0.067	A1ZBX8_DROME Leucine-rich tendon-specific protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrt PE=4 SV=2
18	Q6GU68	1.60e-10	67.4	428	0.024	0.079	ISLR_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein OS=Mus musculus OX=10090 GN=Islr PE=1 SV=1
19	D0IQL1	1.65e-10	68.2	830	0.039	0.065	D0IQL1_DROME Leucine-rich tendon-specific protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Lrt PE=2 SV=1
20	O75094	2.14e-10	68.2	1523	0.031	0.028	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00059 Lectin_C	8.1e-05	34.7	Lectin C-type domain
2	PF01463 LRRCT	8.5	18.2	Leucine rich repeat C-terminal domain
3	PF01462 LRRNT	0.11	23.4	Leucine rich repeat N-terminal domain
4	PF12799 LRR_4	40	16.1	Leucine Rich repeats (2 copies)
5	PF13855 LRR_8	6e-08	43.6	Leucine rich repeat
6	PF00801 PKD	1.2e-91	311.9	PKD domain
7	PF16820 PKD_3	27	16.0	PKD-like domain
8	PF18911 PKD_4	2.6e-35	131.7	PKD domain
9	PF01822 WSC	7.9e-05	34.1	WSC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237596	0.994	Polycystin-2
2	9606.ENSP00000219476	0.988	Tuberin
3	9606.ENSP00000261769	0.983	Cadherin-1
4	9606.ENSP00000211998	0.949	Vinculin
5	9606.ENSP00000360158	0.936	Fibrocystin
6	9606.ENSP00000341189	0.914	Focal adhesion kinase 1
7	9606.ENSP00000419313	0.833	Short transient receptor potential channel 1
8	9606.ENSP00000306010	0.831	ADP-ribosylation factor 4
9	9606.ENSP00000251268	0.817	Multiple epidermal growth factor-like domains protein 8
10	9606.ENSP00000344456	0.804	Catenin beta-1
11	9606.ENSP00000313169	0.801	Nephrocystin-1
12	9606.ENSP00000429900	0.766	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
13	9606.ENSP00000447300	0.765	Rab-3A-interacting protein
14	9606.ENSP00000300935	0.752	Ras-related protein Rab-8A
15	9606.ENSP00000406191	0.734	Transient receptor potential cation channel subfamily V member 4
16	9606.ENSP00000378368	0.709	Flotillin-2
17	9606.ENSP00000346839	0.707	Fibronectin type III domain containing
18	9606.ENSP00000355523	0.704	Regulator of G-protein signaling 7
19	9606.ENSP00000362680	0.704	Proto-oncogene tyrosine-protein kinase Src
20	9606.ENSP00000484855	0.702	Exocyst complex component 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0022803	0.999	passive transmembrane transporter activity
GO:0046873	0.995	metal ion transmembrane transporter activity
GO:1901702	0.975	salt transmembrane transporter activity
GO:0015267	0.783	channel activity
GO:0005216	0.703	monoatomic ion channel activity
GO:0005261	0.657	monoatomic cation channel activity
GO:0015085	0.534	calcium ion transmembrane transporter activity
GO:0038023	0.376	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.943	biological regulation
GO:0032501	0.847	multicellular organismal process
GO:0050789	0.840	regulation of biological process
GO:0050794	0.807	regulation of cellular process
GO:0007275	0.796	multicellular organism development
GO:0048513	0.596	animal organ development
GO:0009987	0.565	cellular process
GO:0048731	0.519	system development
GO:0048519	0.426	negative regulation of biological process
GO:0019222	0.385	regulation of metabolic process
GO:0009653	0.362	anatomical structure morphogenesis
GO:0035295	0.331	tube development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0012505	0.968	endomembrane system
GO:0005794	0.882	Golgi apparatus
GO:0032991	0.763	protein-containing complex
GO:0005929	0.452	cilium
GO:0031982	0.415	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.534	Ca(2+)(in) = Ca(2+)(out)

[back to server]