StarFunc result for job id P98164

User Input

>input (1400 residues)
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98163	0.315	0.232	0.000	1984	0.300	0.212	P98163.pdb.gz	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
2	AFDB:Q53TL0	0.367	0.656	0.000	773	0.552	1.000	Q53TL0.pdb.gz	Q53TL0_HUMAN Uncharacterized protein LRP2 (Fragment) OS=Homo sapiens OX=9606 GN=LRP2 PE=4 SV=1
3	AFDB:O75096	0.440	0.334	2.458E-100	1905	0.266	0.195	O75096.pdb.gz	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
4	AFDB:Q6X0I2	0.296	0.240	1.063E-98	1782	0.285	0.224	Q6X0I2.pdb.gz	VGR_SOLIN Vitellogenin receptor OS=Solenopsis invicta OX=13686 GN=VgR PE=2 SV=1
5	AFDB:Q9VXM0	0.427	0.310	1.104E-90	2009	0.231	0.161	Q9VXM0.pdb.gz	Q9VXM0_DROME LDL receptor related protein 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrp4 PE=4 SV=1
6	AFDB:F1QTJ4	0.380	0.334	1.325E-74	1615	0.200	0.173	F1QTJ4.pdb.gz	F1QTJ4_DANRE Low density lipoprotein receptor-related protein 5 OS=Danio rerio OX=7955 GN=LRP6 PE=1 SV=1
7	AFDB:A0A0G2K0H3	0.356	0.316	1.024E-73	1613	0.210	0.182	A0A0G2K0H3.pdb.gz	A0A0G2K0H3_RAT Low-density lipoprotein receptor-related protein OS=Rattus norvegicus OX=10116 GN=Lrp6 PE=3 SV=1
8	AFDB:O75197	0.348	0.307	2.061E-73	1615	0.181	0.157	O75197.pdb.gz	LRP5_HUMAN Low-density lipoprotein receptor-related protein 5 OS=Homo sapiens OX=9606 GN=LRP5 PE=1 SV=2
9	AFDB:A1Z9D7	0.330	0.285	2.348E-71	1678	0.194	0.162	A1Z9D7.pdb.gz	A1Z9D7_DROME Low-density lipoprotein receptor-related protein OS=Drosophila melanogaster OX=7227 GN=arr PE=2 SV=1
10	AFDB:F1M443	0.307	0.551	3.083E-66	752	0.191	0.355	F1M443.pdb.gz	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
11	PDB:7mq8LT	0.145	0.222	6.975E-16	869	0.050	0.081	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LN	0.148	0.293	6.686E-15	671	0.044	0.091	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7mq8LR	0.145	0.247	7.857E-15	773	0.045	0.082	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajtUA	0.171	0.265	3.360E-14	834	0.044	0.073	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7ajuUL	0.168	0.276	4.397E-14	779	0.041	0.073	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:1n6dA	0.138	0.185	4.896E-14	1023	0.050	0.068	1n6dA.pdb.gz	Navigation Inside a Protease: Substrate Selection and Product Exit in the Tricorn Protease from Thermoplasma acidophilum
17	PDB:7d5sBE	0.142	0.218	5.754E-14	865	0.045	0.073	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:7rroe	0.199	0.383	7.531E-14	610	0.049	0.113	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
19	PDB:1nr0A	0.170	0.343	8.387E-14	610	0.041	0.095	1nr0A.pdb.gz
20	PDB:7mq8LO	0.177	0.271	2.460E-13	848	0.034	0.055	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AQY2	606	4469	0.286	0.090	A0A8I6AQY2_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=1
2	A2ARV4	2254	4660	0.752	0.226	LRP2_MOUSE Low-density lipoprotein receptor-related protein 2 OS=Mus musculus OX=10090 GN=Lrp2 PE=1 SV=1
3	A8JTM7	953	4769	0.401	0.118	A8JTM7_DROME Megalin, isoform A OS=Drosophila melanogaster OX=7227 GN=mgl PE=1 SV=2
4	C0HL13	2062	4652	0.684	0.206	LRP2_PIG Low-density lipoprotein receptor-related protein 2 OS=Sus scrofa OX=9823 GN=LRP2 PE=1 SV=1
5	E0AE56	1950	4673	0.644	0.193	E0AE56_DANRE Low-density lipoprotein receptor-related protein 2 OS=Danio rerio OX=7955 GN=lrp2 PE=1 SV=1
6	E1BGJ0	731	4545	0.327	0.101	E1BGJ0_BOVIN LDL receptor related protein 1 OS=Bos taurus OX=9913 GN=LRP1 PE=1 SV=3
7	F1M443	607	4436	0.286	0.090	F1M443_RAT LDL receptor related protein 1B OS=Rattus norvegicus OX=10116 GN=Lrp1b PE=3 SV=4
8	F1QY34	707	4549	0.324	0.100	F1QY34_DANRE Low density lipoprotein receptor-related protein 1Ab OS=Danio rerio OX=7955 GN=lrp1ab PE=1 SV=1
9	G3V928	732	4545	0.328	0.101	LRP1_RAT Prolow-density lipoprotein receptor-related protein 1 OS=Rattus norvegicus OX=10116 GN=Lrp1 PE=1 SV=1
10	O75096	620	1905	0.264	0.194	LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens OX=9606 GN=LRP4 PE=1 SV=4
11	P98158	2243	4660	0.745	0.224	LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Lrp2 PE=1 SV=1
12	P98164	2908	4655	1.000	0.301	LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens OX=9606 GN=LRP2 PE=1 SV=3
13	Q04833	800	4753	0.362	0.107	LRP_CAEEL Low-density lipoprotein receptor-related protein OS=Caenorhabditis elegans OX=6239 GN=lrp-1 PE=1 SV=1
14	Q07954	733	4544	0.328	0.101	LRP1_HUMAN Prolow-density lipoprotein receptor-related protein 1 OS=Homo sapiens OX=9606 GN=LRP1 PE=1 SV=2
15	Q4ZG84	1319	3881	0.447	0.161	Q4ZG84_HUMAN Uncharacterized protein LRP2 (Fragment) OS=Homo sapiens OX=9606 GN=LRP2 PE=3 SV=1
16	Q53TL0	1588	773	0.552	1.000	Q53TL0_HUMAN Uncharacterized protein LRP2 (Fragment) OS=Homo sapiens OX=9606 GN=LRP2 PE=4 SV=1
17	Q7Z5C0	2906	4655	0.999	0.301	Q7Z5C0_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
18	Q7Z5C1	2904	4655	0.999	0.300	Q7Z5C1_HUMAN Glycoprotein receptor gp330/megalin OS=Homo sapiens OX=9606 PE=2 SV=1
19	Q8VI56	615	1905	0.260	0.191	LRP4_MOUSE Low-density lipoprotein receptor-related protein 4 OS=Mus musculus OX=10090 GN=Lrp4 PE=1 SV=3
20	Q91ZX7	734	4545	0.328	0.101	LRP1_MOUSE Prolow-density lipoprotein receptor-related protein 1 OS=Mus musculus OX=10090 GN=Lrp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	0.0043	28.2	Complement Clr-like EGF-like
2	PF14670 FXa_inhibition	4e-14	64.0	Coagulation Factor Xa inhibitory site
3	PF00057 Ldl_recept_a	1e-141	472.1	Low-density lipoprotein receptor domain class A
4	PF00058 Ldl_recept_b	4.3e-53	188.8	Low-density lipoprotein receptor repeat class B

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263816

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367064	0.999	Cubilin
2	9606.ENSP00000421725	0.998	Vitamin D-binding protein
3	9606.ENSP00000315130	0.996	Clusterin
4	9606.ENSP00000421922	0.996	Alpha-2-macroglobulin receptor-associated protein
5	9606.ENSP00000220616	0.995	Thyroglobulin
6	9606.ENSP00000297261	0.993	Sonic hedgehog protein
7	9606.ENSP00000252486	0.992	Apolipoprotein E
8	9606.ENSP00000313391	0.992	Disabled homolog 2
9	9606.ENSP00000295897	0.991	Serum albumin
10	9606.ENSP00000308938	0.988	Plasminogen
11	9606.ENSP00000299155	0.987	Protein amnionless
12	9606.ENSP00000362108	0.987	Neutrophil gelatinase-associated lipocalin
13	9606.ENSP00000264938	0.986	Sodium/hydrogen exchanger 3
14	9606.ENSP00000363458	0.975	Low density lipoprotein receptor adapter protein 1
15	9606.ENSP00000369816	0.973	Sex hormone-binding globulin
16	9606.ENSP00000233242	0.966	Apolipoprotein B-100
17	9606.ENSP00000236850	0.959	Apolipoprotein A-I
18	9606.ENSP00000420939	0.959	Selenoprotein P
19	9606.ENSP00000296785	0.958	Ankyrin repeat family A protein 2
20	9606.ENSP00000376753	0.956	PDZ domain-containing protein GIPC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038024	0.787	cargo receptor activity
GO:0005041	0.701	low-density lipoprotein particle receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006898	0.979	receptor-mediated endocytosis
GO:0065007	0.787	biological regulation
GO:0009987	0.612	cellular process
GO:0050789	0.449	regulation of biological process
GO:0050794	0.301	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0031090	0.914	organelle membrane
GO:0098588	0.897	bounding membrane of organelle
GO:0005773	0.877	vacuole
GO:0005764	0.824	lysosome
GO:0098852	0.797	lytic vacuole membrane
GO:0005765	0.786	lysosomal membrane
GO:0071944	0.394	cell periphery
GO:0005886	0.343	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]