StarFunc result for job id P98168

User Input

>input (799 residues)
MEIPKLLPARGTLQGGGGGGIPAGGGRVHRGPDSPAGQVPTRRLLLPRGPQDGGPGRRRE
EASTASRGPGPSLFAPRPHQPSGGGDDFFLVLLDPVGGDVETAGSGQAAGPVLREEAKAG
PGLQGDESGANPAGCSAQGPHCLSAVPTPAPISAPGPAAAFAGTVTIHNQDLLLRFENGV
LTLATPPPHAWEPGAAPAQQPRCLIAPQAGFPQAAHPGDCPELRSDLLLAEPAEPAPAPA
PQEEAEGLAAALGPRGLLGSGPGVVLYLCPEALCGQTFAKKHQLKMHLLTHSSSQGQRPF
KCPLGGCGWTFTTSYKLKRHLQSHDKLRPFGCPAEGCGKSFTTVYNLKAHMKGHEQENSF
KCEVCEESFPTQAKLGAHQRSHFEPERPYQCAFSGCKKTFITVSALFSHNRAHFREQELF
SCSFPGCSKQYDKACRLKIHLRSHTGERPFLCDFDGCGWNFTSMSKLLRHKRKHDDDRRF
MCPVEGCGKSFTRAEHLKGHSITHLGTKPFVCPVAGCCARFSARSSLYIHSKKHLQDVDT
WKSRCPISSCNKLFTSKHSMKTHMVKRHKVGQDLLAQLEAANSLTPSSELTSQRQNDLSD
AEIVSLFSDVPDSTSAALLDTALVNSGILTIDVASVSSTLAGHLPANNNNSVGQAVDPPS
LMATSDPPQSLDTSLFFGTAATGFQQSSLNMDEVSSVSVGPLGSLDSLAMKNSSPEPQAL
TPSSKLTVDTDTLTPSSTLCENSVSELLTPAKAEWSVHPNSDFFGQEGETQFGFPNAAGN
HGSQKERNLITVTGSSFLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98169	0.422	0.420	0.000	803	0.966	0.961	P98169.pdb.gz	ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens OX=9606 GN=ZXDB PE=1 SV=2
2	AFDB:Q2QGD7	0.361	0.339	3.311E-68	858	0.568	0.529	Q2QGD7.pdb.gz	ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2
3	AFDB:Q9BYN7	0.177	0.166	1.178E-21	854	0.207	0.193	Q9BYN7.pdb.gz	ZN341_HUMAN Zinc finger protein 341 OS=Homo sapiens OX=9606 GN=ZNF341 PE=1 SV=2
4	AFDB:Q9UFB7	0.261	0.277	7.137E-19	747	0.169	0.181	Q9UFB7.pdb.gz	ZBT47_HUMAN Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3
5	AFDB:E9PEP7	0.114	0.118	9.632E-16	755	0.149	0.158	E9PEP7.pdb.gz	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
6	AFDB:P41183	0.185	0.206	8.848E-15	707	0.146	0.165	P41183.pdb.gz	BCL6_MOUSE B-cell lymphoma 6 protein homolog OS=Mus musculus OX=10090 GN=Bcl6 PE=1 SV=1
7	AFDB:A7Y7X5	0.201	0.209	2.521E-14	761	0.140	0.147	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
8	AFDB:Q13127	0.202	0.153	1.222E-12	1097	0.145	0.106	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
9	AFDB:Q6XP49	0.147	0.150	1.881E-12	780	0.180	0.185	Q6XP49.pdb.gz	GLIS3_MOUSE Zinc finger protein GLIS3 OS=Mus musculus OX=10090 GN=Glis3 PE=1 SV=2
10	AFDB:A0A024R4Z1	0.127	0.169	5.040E-12	570	0.154	0.216	A0A024R4Z1.pdb.gz
11	PDB:7b5lH	0.057	0.080	3.296E-1	423	0.060	0.113	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
12	PDB:5apny	0.041	0.101	1.446	211	0.038	0.142	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
13	PDB:6o9lQ	0.042	0.069	1.967	430	0.064	0.119	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
14	PDB:7pt6I	0.045	0.075	2.092	341	0.039	0.091	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
15	PDB:5lzbz	0.048	0.058	2.366	614	0.036	0.047	5lzbz.pdb.gz	The pathway to GTPase activation of elongation factor SelB on the ribosome.
16	PDB:7z1mO	0.053	0.063	2.517	570	0.049	0.068	7z1mO.pdb.gz	Architecture of the yeast Pol III pre-termination complex and pausing mechanism on poly(dT) termination signals.
17	PDB:5apnH	0.033	0.136	2.677	191	0.001	0.005	5apnH.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:5xbtA	0.038	0.062	2.677	271	0.024	0.070	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
19	PDB:6zqbJO	0.039	0.087	3.028	236	0.051	0.174	6zqbJO.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
20	PDB:2k8pA	0.036	0.115	3.220	189	0.035	0.148	2k8pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98168	0.0	1628	799	1.000	1.000	ZXDA_HUMAN Zinc finger X-linked protein ZXDA OS=Homo sapiens OX=9606 GN=ZXDA PE=1 SV=2
2	P98169	0.0	1557	803	0.966	0.961	ZXDB_HUMAN Zinc finger X-linked protein ZXDB OS=Homo sapiens OX=9606 GN=ZXDB PE=1 SV=2
3	Q2QGD7	0.0	727	858	0.472	0.439	ZXDC_HUMAN Zinc finger protein ZXDC OS=Homo sapiens OX=9606 GN=ZXDC PE=1 SV=2
4	Q9H891	1.52e-45	170	391	0.154	0.315	Q9H891_HUMAN cDNA FLJ13861 fis, clone THYRO1001100, moderately similar to ZINC FINGER X-LINKED PROTEIN ZXDA OS=Homo sapiens OX=9606 PE=1 SV=1
5	P52747	5.46e-41	162	638	0.104	0.130	ZN143_HUMAN Zinc finger protein 143 OS=Homo sapiens OX=9606 GN=ZNF143 PE=1 SV=2
6	Q5XIU2	3.00e-40	160	638	0.103	0.129	ZN143_RAT Zinc finger protein 143 OS=Rattus norvegicus OX=10116 GN=Znf143 PE=2 SV=2
7	O70230	4.47e-40	159	638	0.103	0.129	ZN143_MOUSE Zinc finger protein 143 OS=Mus musculus OX=10090 GN=Znf143 PE=1 SV=2
8	Q9UEG4	5.87e-40	160	869	0.133	0.122	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
9	P36508	1.18e-39	157	570	0.099	0.139	ZNF76_HUMAN Zinc finger protein 76 OS=Homo sapiens OX=9606 GN=ZNF76 PE=1 SV=2
10	Q8BMU0	6.57e-39	155	568	0.098	0.137	ZNF76_MOUSE Zinc finger protein 76 OS=Mus musculus OX=10090 GN=Znf76 PE=2 SV=1
11	P51814	7.44e-38	154	821	0.134	0.130	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
12	P13682	1.86e-37	150	527	0.130	0.197	ZNF35_HUMAN Zinc finger protein 35 OS=Homo sapiens OX=9606 GN=ZNF35 PE=1 SV=4
13	Q9UJW8	2.37e-37	151	692	0.119	0.137	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
14	Q9C0F3	3.06e-37	148	470	0.139	0.236	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
15	Q1LYE3	3.41e-37	150	623	0.099	0.127	ZN143_DANRE Zinc finger protein 143 OS=Danio rerio OX=7955 GN=znf143 PE=2 SV=2
16	Q60821	5.86e-37	151	794	0.119	0.120	ZBT17_MOUSE Zinc finger and BTB domain-containing protein 17 OS=Mus musculus OX=10090 GN=Zbtb17 PE=1 SV=2
17	O88412	7.16e-37	148	524	0.134	0.204	O88412_MOUSE Zinc finger protein 105 OS=Mus musculus OX=10090 GN=Zfp105 PE=2 SV=1
18	Q13105	1.38e-36	150	803	0.118	0.117	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
19	Q9H5H4	1.72e-36	147	540	0.120	0.178	ZN768_HUMAN Zinc finger protein 768 OS=Homo sapiens OX=9606 GN=ZNF768 PE=1 SV=2
20	Q96NJ6	2.24e-36	146	502	0.133	0.211	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01485 IBR	1.2e+02	14.3	IBR domain, a half RING-finger domain
2	PF00096 zf-C2H2	1.5e-28	108.8	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	4.7e-21	84.6	C2H2-type zinc finger
4	PF13912 zf-C2H2_6	0.0058	27.9	C2H2-type zinc finger
5	PF15909 zf-C2H2_8	1.3e-05	36.7	C2H2-type zinc ribbon
6	PF17017 zf-C2H2_aberr	0.0039	28.9	Aberrant zinc-finger
7	PF13465 zf-H2C2_2	2.4e-17	73.7	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000485010	0.803	MHC class II transactivator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140110	0.971	transcription regulator activity
GO:0003676	0.847	nucleic acid binding
GO:0003712	0.845	transcription coregulator activity
GO:0003713	0.837	transcription coactivator activity
GO:0019904	0.832	protein domain specific binding
GO:0003677	0.795	DNA binding
GO:0000976	0.750	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0010468	0.982	regulation of gene expression
GO:0031326	0.980	regulation of cellular biosynthetic process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0048518	0.828	positive regulation of biological process
GO:0048522	0.817	positive regulation of cellular process
GO:0009893	0.776	positive regulation of metabolic process
GO:0031325	0.726	positive regulation of cellular metabolic process
GO:0010557	0.724	positive regulation of macromolecule biosynthetic process
GO:0051254	0.722	positive regulation of RNA metabolic process
GO:0045893	0.710	positive regulation of DNA-templated transcription
GO:0009987	0.674	cellular process
GO:0050896	0.340	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.991	nucleoplasm
GO:0005737	0.974	cytoplasm
GO:0005829	0.949	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]