StarFunc result for job id P98170

User Input

>input (497 residues)
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98170	1.000	1.000	1.773E-88	497	1.000	1.000	P98170.pdb.gz	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
2	AFDB:Q60989	0.704	0.705	1.356E-76	496	0.893	0.895	Q60989.pdb.gz	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
3	AFDB:H0YZU0	0.433	0.443	2.873E-54	485	0.509	0.522	H0YZU0.pdb.gz	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
4	AFDB:A5D8Q0	0.448	0.455	3.264E-52	488	0.485	0.494	A5D8Q0.pdb.gz	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
5	AFDB:F7FLN8	0.194	0.154	2.995E-38	638	0.400	0.312	F7FLN8.pdb.gz	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
6	AFDB:A0A669KBC7	0.190	0.152	4.887E-38	645	0.412	0.318	A0A669KBC7.pdb.gz	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
7	AFDB:O08863	0.229	0.194	5.652E-37	600	0.382	0.317	O08863.pdb.gz	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
8	AFDB:Q13489	0.193	0.161	2.325E-36	604	0.406	0.334	Q13489.pdb.gz	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
9	AFDB:Q62210	0.192	0.158	3.052E-36	612	0.400	0.325	Q62210.pdb.gz	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
10	AFDB:Q13490	0.192	0.158	6.902E-36	618	0.398	0.320	Q13490.pdb.gz	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
11	PDB:6b5bA	0.167	0.080	3.765E-12	1199	0.193	0.080	6b5bA.pdb.gz
12	PDB:5yudA	0.157	0.064	2.187E-9	1238	0.127	0.051	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
13	PDB:1m4mA	0.139	0.570	6.047E-5	112	0.058	0.259	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
14	PDB:3uedC	0.142	0.473	1.367E-4	139	0.044	0.158	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
15	PDB:4r8pL	0.102	0.188	2.317	254	0.030	0.059	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:2c2lA	0.107	0.160	4.214	281	0.028	0.050	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
17	PDB:7zs9M	0.082	0.121	4.450	310	0.052	0.084	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
18	PDB:5gm6I	0.067	0.252	4.962	102	0.030	0.147	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:7tgxB	0.080	0.043	4.962	1081	0.054	0.025	7tgxB.pdb.gz
20	PDB:8h11B	0.079	0.046	5.239	992	0.054	0.027	8h11B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YZU0	0.0	524	485	0.511	0.524	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
2	P98170	0.0	1050	497	1.000	1.000	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
3	Q60989	0.0	942	496	0.893	0.895	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
4	Q9R0I6	0.0	954	496	0.897	0.899	XIAP_RAT E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1
5	A5D8Q0	3.43e-179	513	488	0.491	0.500	XIAP_XENLA E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2
6	Q6PIA0	7.15e-143	411	236	0.378	0.797	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
7	Q13490	6.43e-87	281	618	0.324	0.261	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
8	A0A8I6ADV9	6.63e-86	276	537	0.330	0.305	A0A8I6ADV9_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=4 SV=1
9	Q62210	1.47e-85	277	612	0.330	0.268	BIRC2_MOUSE Baculoviral IAP repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Birc2 PE=1 SV=1
10	Q6P6S1	1.72e-85	276	589	0.332	0.280	Q6P6S1_RAT Baculoviral IAP repeat-containing 2 OS=Rattus norvegicus OX=10116 GN=Birc2 PE=3 SV=1
11	Q8JHV9	5.58e-84	267	401	0.286	0.354	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
12	F7FLN8	1.06e-83	272	602	0.324	0.267	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3
13	Q5XIW4	1.06e-83	272	602	0.324	0.267	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
14	A0A0G2JTI9	2.36e-83	272	638	0.338	0.263	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
15	Q13489	9.89e-83	270	604	0.320	0.263	BIRC3_HUMAN Baculoviral IAP repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=2
16	Q90660	3.53e-80	263	611	0.330	0.268	BIR_CHICK Inhibitor of apoptosis protein OS=Gallus gallus OX=9031 GN=ITA PE=2 SV=1
17	O08863	1.15e-79	261	600	0.318	0.263	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
18	A0A669KBC7	1.37e-74	249	645	0.320	0.247	A0A669KBC7_HUMAN Baculoviral IAP repeat containing 3 OS=Homo sapiens OX=9606 GN=BIRC3 PE=1 SV=1
19	Q24307	1.60e-74	245	498	0.318	0.317	DIAP2_DROME Death-associated inhibitor of apoptosis 2 OS=Drosophila melanogaster OX=7227 GN=Diap2 PE=1 SV=3
20	Q9R016	5.44e-42	162	1403	0.229	0.081	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	6.6e-56	198.2	Inhibitor of Apoptosis domain
2	PF10217 DUF2039	5.4e+02	12.3	Uncharacterized conserved protein (DUF2039)
3	PF14447 Prok-RING_4	0.0051	28.0	Prokaryotic RING finger family 4
4	PF13923 zf-C3HC4_2	57	15.0	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	1.5e-09	48.9	Zinc finger, C3HC4 type (RING finger)
6	PF13445 zf-RING_UBOX	2.2e+02	13.3	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360242

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216160	0.999	TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
2	9606.ENSP00000220751	0.999	Receptor-interacting serine/threonine-protein kinase 2
3	9606.ENSP00000258080	0.999	Serine protease HTRA2, mitochondrial
4	9606.ENSP00000311032	0.999	Caspase-3
5	9606.ENSP00000330237	0.999	Caspase-9
6	9606.ENSP00000358327	0.999	Caspase-7
7	9606.ENSP00000398495	0.999	Diablo homolog, mitochondrial
8	9606.ENSP00000402000	0.999	Septin-4
9	9606.ENSP00000354822	0.998	XIAP-associated factor 1
10	9606.ENSP00000448165	0.996	Apoptotic protease-activating factor 1
11	9606.ENSP00000364133	0.995	TGF-beta receptor type-1
12	9606.ENSP00000477613	0.989	Baculoviral IAP repeat-containing protein 2
13	9606.ENSP00000358335	0.984	Mitogen-activated protein kinase kinase kinase 7
14	9606.ENSP00000269321	0.982	Rho GDP-dissociation inhibitor 1
15	9606.ENSP00000441543	0.982	Polyubiquitin-C
16	9606.ENSP00000361021	0.978	Phosphatase and tensin homolog
17	9606.ENSP00000351273	0.970	Caspase-8
18	9606.ENSP00000216274	0.966	Receptor-interacting serine/threonine-protein kinase 3
19	9606.ENSP00000259808	0.962	Receptor-interacting serine/threonine-protein kinase 1
20	9606.ENSP00000451828	0.955	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0019899	0.994	enzyme binding
GO:0140096	0.988	catalytic activity, acting on a protein
GO:0019787	0.978	ubiquitin-like protein transferase activity
GO:0043027	0.956	cysteine-type endopeptidase inhibitor activity involved in apoptotic process
GO:0004842	0.937	ubiquitin-protein transferase activity
GO:0042802	0.913	identical protein binding
GO:0019900	0.607	kinase binding
GO:0019901	0.519	protein kinase binding
GO:0061630	0.417	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0051716	0.982	cellular response to stimulus
GO:0048583	0.980	regulation of response to stimulus
GO:0043067	0.976	regulation of programmed cell death
GO:0060548	0.975	negative regulation of cell death
GO:0043069	0.974	negative regulation of programmed cell death
GO:0048522	0.972	positive regulation of cellular process
GO:0023051	0.968	regulation of signaling
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0009966	0.961	regulation of signal transduction
GO:0006950	0.944	response to stress
GO:0010468	0.912	regulation of gene expression
GO:0043066	0.896	negative regulation of apoptotic process
GO:0009967	0.884	positive regulation of signal transduction
GO:1903318	0.865	negative regulation of protein maturation
GO:0070613	0.857	regulation of protein processing
GO:0030111	0.838	regulation of Wnt signaling pathway
GO:1902533	0.830	positive regulation of intracellular signal transduction
GO:0065009	0.829	regulation of molecular function
GO:0050776	0.820	regulation of immune response
GO:0010955	0.810	negative regulation of protein processing
GO:0031401	0.804	positive regulation of protein modification process
GO:0031347	0.788	regulation of defense response
GO:0050790	0.772	regulation of catalytic activity
GO:0042592	0.737	homeostatic process
GO:0033554	0.737	cellular response to stress
GO:0052548	0.735	regulation of endopeptidase activity
GO:0043281	0.717	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1903320	0.706	regulation of protein modification by small protein conjugation or removal
GO:0031396	0.703	regulation of protein ubiquitination
GO:0032101	0.698	regulation of response to external stimulus
GO:0090263	0.698	positive regulation of canonical Wnt signaling pathway
GO:0009968	0.690	negative regulation of signal transduction
GO:0042221	0.660	response to chemical
GO:0031323	0.660	regulation of cellular metabolic process
GO:0045088	0.651	regulation of innate immune response
GO:1903322	0.642	positive regulation of protein modification by small protein conjugation or removal
GO:0044092	0.641	negative regulation of molecular function
GO:0043086	0.632	negative regulation of catalytic activity
GO:2000117	0.621	negative regulation of cysteine-type endopeptidase activity
GO:0031398	0.614	positive regulation of protein ubiquitination
GO:0043154	0.614	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0071704	0.598	organic substance metabolic process
GO:0001959	0.563	regulation of cytokine-mediated signaling pathway
GO:0062207	0.548	regulation of pattern recognition receptor signaling pathway
GO:0043170	0.522	macromolecule metabolic process
GO:0044238	0.516	primary metabolic process
GO:0070887	0.508	cellular response to chemical stimulus
GO:0006807	0.487	nitrogen compound metabolic process
GO:0010033	0.478	response to organic substance
GO:0060761	0.444	negative regulation of response to cytokine stimulus
GO:0039531	0.414	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:1901564	0.396	organonitrogen compound metabolic process
GO:0032501	0.368	multicellular organismal process
GO:0019538	0.338	protein metabolic process
GO:0012501	0.337	programmed cell death
GO:0007154	0.325	cell communication
GO:0080135	0.318	regulation of cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0032991	0.961	protein-containing complex
GO:0016020	0.368	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.980	Transferases.

[back to server]