StarFunc result for job id P98171

User Input

>input (946 residues)
MAAHGKLRRERGLQAEYETQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLEKLAERFSSRGGRLGSSREHQSFRKEPSLLSPLHCWAVLLQHTRQQSRESAAL
SEVLAGPLAQRLSHIAEDVGRLVKKSRDLEQQLQDELLEVVSELQTAKKTYQAYHMESVN
AEAKLREAERQEEKRAGRSVPTTTAGATEAGPLRKSSLKKGGRLVEKRQAKFMEHKLKCT
KARNEYLLSLASVNAAVSNYYLHDVLDLMDCCDTGFHLALGQVLRSYTAAESRTQASQVQ
GLGSLEEAVEALDPPGDKAKVLEVHATVFCPPLRFDYHPHDGDEVAEICVEMELRDEILP
RAQNIQSRLDRQTIETEEVNKTLKATLQALLEVVASDDGDVLDSFQTSPSTESLKSTSSD
PGSRQAGRRRGQQQETETFYLTKLQEYLSGRSILAKLQAKHEKLQEALQRGDKEEQEVSW
TQYTQRKFQKSRQPRPSSQYNQRLFGGDMEKFIQSSGQPVPLVVESCIRFINLNGLQHEG
IFRVSGAQLRVSEIRDAFERGEDPLVEGCTAHDLDSVAGVLKLYFRSLEPPLFPPDLFGE
LLASSELEATAERVEHVSRLLWRLPAPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCF
GPTLLPVPAGQDPVALQGRVNQLVQTLIVQPDRVFPPLTSLPGPVYEKCMAPPSASCLGD
AQLESLGADNEPELEAEMPAQEDDLEGVVEAVACFAYTGRTAQELSFRRGDVLRLHERAS
SDWWRGEHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPC
TSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSP
SPGPRSPKAPPSSRLGRNKGFSRGPGAPASPSASHPQGLDTTPKPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98171	1.000	1.000	0.000	946	1.000	1.000	P98171.pdb.gz	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
2	AFDB:E7EQN5	0.440	0.450	4.951E-104	925	0.975	0.997	E7EQN5.pdb.gz	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
3	AFDB:O43295	0.471	0.407	9.645E-63	1099	0.462	0.398	O43295.pdb.gz	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
4	AFDB:Q91Z69	0.456	0.408	5.244E-59	1062	0.425	0.379	Q91Z69.pdb.gz	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
5	AFDB:D4A208	0.451	0.401	8.005E-57	1071	0.421	0.372	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
6	AFDB:Q19370	0.441	0.397	1.520E-39	1059	0.281	0.251	Q19370.pdb.gz	Q19370_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=2
7	AFDB:Q55CK2	0.209	0.224	1.871E-18	877	0.148	0.160	Q55CK2.pdb.gz	MGP2_DICDI GTPase activating protein homolog 2 OS=Dictyostelium discoideum OX=44689 GN=mgp2 PE=3 SV=1
8	AFDB:D3ZFJ3	0.196	0.268	1.461E-15	689	0.144	0.197	D3ZFJ3.pdb.gz	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1
9	AFDB:Q9VDS5	0.191	0.243	5.023E-15	740	0.126	0.161	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
10	AFDB:O94466	0.194	0.257	9.733E-15	695	0.125	0.170	O94466.pdb.gz	RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga7 PE=1 SV=1
11	PDB:3cxlA	0.188	0.431	1.422E-9	402	0.067	0.157	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
12	PDB:1xa6A	0.192	0.446	8.673E-9	399	0.062	0.148	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	PDB:6r3vA	0.196	0.887	2.854E-8	198	0.057	0.273	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
14	PDB:5jcpA	0.169	0.430	9.812E-8	361	0.048	0.125	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.171	0.412	2.706E-7	382	0.052	0.128	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:3hajA	0.131	0.357	6.089E-4	286	0.048	0.157	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:2lqnA	0.059	0.177	8.666E-4	303	0.023	0.073	2lqnA.pdb.gz
18	PDB:6ikoA	0.178	0.491	1.289E-3	303	0.053	0.165	6ikoA.pdb.gz
19	PDB:3qwyA	0.062	0.333	1.408E-3	170	0.017	0.094	3qwyA.pdb.gz
20	PDB:2dybA	0.059	0.184	1.917E-3	298	0.020	0.064	2dybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVF0	0.0	1529	965	0.827	0.810	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
2	A0A8I5ZY52	0.0	1460	921	0.794	0.815	A0A8I5ZY52_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
3	A0A8I6AIK5	0.0	1489	934	0.807	0.817	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
4	A0A8I6AN89	0.0	986	881	0.517	0.555	A0A8I6AN89_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
5	A0A8I6GIQ7	0.0	981	770	0.514	0.631	A0A8I6GIQ7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
6	B7ZM87	0.0	773	1070	0.403	0.356	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
7	D4A208	0.0	770	1071	0.403	0.356	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
8	E7EQN5	0.0	1876	925	0.978	1.000	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
9	E9PCM6	0.0	1239	768	0.636	0.784	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
10	O43295	0.0	829	1099	0.434	0.374	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
11	O75044	0.0	769	1071	0.403	0.356	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
12	P98171	0.0	1929	946	1.000	1.000	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
13	Q7Z6B7	0.0	809	1085	0.416	0.363	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
14	Q812A2	0.0	828	1099	0.433	0.373	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
15	Q8K4G7	0.0	1527	965	0.826	0.809	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1
16	Q91Z67	0.0	773	1071	0.403	0.356	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
17	Q91Z69	0.0	766	1062	0.405	0.361	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
18	A0A286YEY3	8.87e-139	424	459	0.219	0.451	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
19	P0DJJ0	2.69e-135	415	459	0.215	0.442	SRG2C_HUMAN SLIT-ROBO Rho GTPase-activating protein 2C OS=Homo sapiens OX=9606 GN=SRGAP2C PE=1 SV=1
20	Q5VZB4	3.51e-132	407	450	0.219	0.460	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	2.6e-16	71.1	Fes/CIP4, and EFC/F-BAR homology domain
2	PF00620 RhoGAP	8.1e-40	147.6	RhoGAP domain
3	PF00018 SH3_1	9e-09	46.1	SH3 domain
4	PF07653 SH3_2	2.7e-06	38.4	Variant SH3 domain
5	PF14604 SH3_9	1.2e-08	46.1	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000058053

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013653	0.742	Coronin, actin binding protein, 1A
2	9598.ENSPTRP00000043196	0.726	Pan troglodytes ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1) (RAC1), mRNA
3	9598.ENSPTRP00000035797	0.711	Clathrin light chain
4	9598.ENSPTRP00000025759	0.710	Ras homolog family member A
5	9598.ENSPTRP00000021733	0.705	Uncharacterized protein
6	9598.ENSPTRP00000000548	0.687	Cell division cycle 42 (GTP binding protein, 25kDa)
7	9598.ENSPTRP00000026867	0.687	Polyhomeotic homolog 3
8	9598.ENSPTRP00000002599	0.686	Coatomer subunit alpha
9	9598.ENSPTRP00000033635	0.678	Uncharacterized protein
10	9598.ENSPTRP00000005495	0.677	HRas proto-oncogene, GTPase
11	9598.ENSPTRP00000057915	0.669	Ral GTPase activating protein, alpha subunit 2 (catalytic)
12	9598.ENSPTRP00000057096	0.639	Vasopressin V2 receptor
13	9598.ENSPTRP00000024681	0.610	Uncharacterized protein
14	9598.ENSPTRP00000060141	0.610	Uncharacterized protein
15	9598.ENSPTRP00000001916	0.606	Ras homolog gene family, member C
16	9598.ENSPTRP00000021982	0.600	Uncharacterized protein
17	9598.ENSPTRP00000060825	0.593	Ras homolog gene family, member B
18	9598.ENSPTRP00000003972	0.585	Plexin domain containing 2
19	9598.ENSPTRP00000049036	0.570	Myosin IF
20	9598.ENSPTRP00000020124	0.566	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0042802	0.918	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0051128	0.977	regulation of cellular component organization
GO:0048519	0.971	negative regulation of biological process
GO:0032501	0.963	multicellular organismal process
GO:0048523	0.957	negative regulation of cellular process
GO:0016043	0.952	cellular component organization
GO:0048856	0.929	anatomical structure development
GO:0120035	0.918	regulation of plasma membrane bounded cell projection organization
GO:0030334	0.909	regulation of cell migration
GO:0040013	0.907	negative regulation of locomotion
GO:2000146	0.903	negative regulation of cell motility
GO:0051129	0.876	negative regulation of cellular component organization
GO:0030336	0.862	negative regulation of cell migration
GO:0065008	0.860	regulation of biological quality
GO:0051239	0.827	regulation of multicellular organismal process
GO:0007275	0.825	multicellular organism development
GO:0008361	0.825	regulation of cell size
GO:0010762	0.808	regulation of fibroblast migration
GO:0050896	0.777	response to stimulus
GO:0048731	0.759	system development
GO:0030517	0.751	negative regulation of axon extension
GO:0051716	0.660	cellular response to stimulus
GO:0048583	0.660	regulation of response to stimulus
GO:0007154	0.649	cell communication
GO:0023052	0.647	signaling
GO:0007165	0.644	signal transduction
GO:1902531	0.566	regulation of intracellular signal transduction
GO:0051056	0.498	regulation of small GTPase mediated signal transduction
GO:0007399	0.454	nervous system development
GO:0006996	0.405	organelle organization
GO:0007010	0.401	cytoskeleton organization
GO:0035556	0.334	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0031974	0.996	membrane-enclosed lumen
GO:0012505	0.994	endomembrane system
GO:0070013	0.992	intracellular organelle lumen
GO:0005634	0.990	nucleus
GO:0031981	0.982	nuclear lumen
GO:0005654	0.969	nucleoplasm
GO:0043228	0.967	non-membrane-bounded organelle
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0071944	0.917	cell periphery
GO:0016020	0.872	membrane
GO:0005794	0.780	Golgi apparatus
GO:0005856	0.727	cytoskeleton
GO:0005886	0.568	plasma membrane
GO:0043005	0.497	neuron projection
GO:0099512	0.493	supramolecular fiber
GO:0099513	0.459	polymeric cytoskeletal fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]