StarFunc result for job id P98173

User Input

>input (230 residues)
MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCG
LPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEA
RAFDMWAGDVNDLLKFIRPLHEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFR
DSWVFVGAKGVQNKSPFEQHVKNSKHSNKYEGWPEALEMEGCIPRRSTAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98173	1.000	1.000	6.678E-44	230	1.000	1.000	P98173.pdb.gz	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2
2	AFDB:Q96BQ1	0.754	0.773	2.903E-29	224	0.530	0.545	Q96BQ1.pdb.gz	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
3	AFDB:Q92520	0.757	0.767	8.006E-29	227	0.491	0.498	Q92520.pdb.gz	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
4	AFDB:P97805	0.750	0.773	1.501E-27	223	0.487	0.502	P97805.pdb.gz	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
5	AFDB:P58499	0.741	0.725	2.620E-21	235	0.370	0.362	P58499.pdb.gz	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
6	AFDB:Q9D309	0.718	0.703	6.102E-21	235	0.343	0.336	Q9D309.pdb.gz	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
7	PDB:2yopC	0.707	0.891	2.690E-19	181	0.283	0.359	2yopC.pdb.gz
8	AFDB:Q8WZA1	0.593	0.217	1.033E-11	660	0.174	0.061	Q8WZA1.pdb.gz	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
9	AFDB:Q8BI06	0.429	0.076	2.969E-6	1361	0.113	0.019	Q8BI06.pdb.gz	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
10	AFDB:A3KPQ7	0.438	0.078	5.217E-6	1378	0.174	0.029	A3KPQ7.pdb.gz	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
11	AFDB:Q9UHN6	0.431	0.075	7.316E-6	1383	0.126	0.021	Q9UHN6.pdb.gz	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
12	PDB:1u0tB	0.160	0.140	8.621E-1	276	0.100	0.083	1u0tB.pdb.gz
13	PDB:3afkA	0.121	0.151	1.209	167	0.078	0.108	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
14	PDB:1u0rD	0.157	0.129	1.432	301	0.100	0.076	1u0rD.pdb.gz
15	PDB:7tejD	0.138	0.154	1.696	197	0.074	0.086	7tejD.pdb.gz
16	PDB:6wg3A	0.127	0.068	1.898	561	0.087	0.036	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:1eta1	0.138	0.218	2.124	127	0.035	0.063	1eta1.pdb.gz	The x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic Val-30-->Met variant to 1.7-A resolution.
18	PDB:3aqgB	0.095	0.141	2.124	138	0.078	0.130	3aqgB.pdb.gz
19	PDB:6b3rA	0.132	0.033	2.124	1502	0.057	0.009	6b3rA.pdb.gz	Structure-based membrane dome mechanism for Piezo mechanosensitivity.
20	PDB:3ggrC	0.093	0.083	2.516	264	0.104	0.091	3ggrC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98173	7.65e-172	473	230	1.000	1.000	FAM3A_HUMAN Protein FAM3A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=2
2	Q96BQ1	9.60e-90	265	224	0.530	0.545	FAM3D_HUMAN Protein FAM3D OS=Homo sapiens OX=9606 GN=FAM3D PE=1 SV=1
3	Q92520	6.85e-83	248	227	0.452	0.458	FAM3C_HUMAN Protein FAM3C OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
4	P97805	6.38e-79	238	223	0.478	0.493	FAM3D_MOUSE Protein FAM3D OS=Mus musculus OX=10090 GN=Fam3d PE=2 SV=2
5	P58499	5.10e-44	149	235	0.309	0.302	FAM3B_HUMAN Protein FAM3B OS=Homo sapiens OX=9606 GN=FAM3B PE=1 SV=2
6	Q9D309	3.17e-41	142	235	0.309	0.302	FAM3B_MOUSE Protein FAM3B OS=Mus musculus OX=10090 GN=Fam3b PE=1 SV=1
7	C9JMN4	7.01e-41	139	151	0.252	0.384	C9JMN4_HUMAN FAM3 metabolism regulating signaling molecule C (Fragment) OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
8	C9JP35	1.52e-35	124	109	0.230	0.486	C9JP35_HUMAN FAM3 metabolism regulating signaling molecule C (Fragment) OS=Homo sapiens OX=9606 GN=FAM3C PE=1 SV=1
9	Q9BU27	4.58e-15	69.7	70	0.222	0.729	Q9BU27_HUMAN FAM3 metabolism regulating signaling molecule A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=1
10	Q8WZA1	5.17e-07	52.0	660	0.104	0.036	PMGT1_HUMAN Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2
11	Q91X88	5.17e-07	52.0	660	0.104	0.036	PMGT1_MOUSE Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1
12	Q8WUJ3	1.72e-06	50.8	1361	0.122	0.021	CEMIP_HUMAN Cell migration-inducing and hyaluronan-binding protein OS=Homo sapiens OX=9606 GN=CEMIP PE=1 SV=2
13	Q8BI06	3.33e-06	49.7	1361	0.113	0.019	CEMIP_MOUSE Cell migration-inducing and hyaluronan-binding protein OS=Mus musculus OX=10090 GN=Cemip PE=1 SV=4
14	A3KPQ7	3.04e-04	43.9	1378	0.130	0.022	CEIP2_DANRE Cell surface hyaluronidase OS=Danio rerio OX=7955 GN=cemip2 PE=1 SV=1
15	Q9UHN6	5.75e-04	43.1	1383	0.109	0.018	CEIP2_HUMAN Inactive cell surface hyaluronidase CEMIP2 OS=Homo sapiens OX=9606 GN=CEMIP2 PE=1 SV=1
16	Q3UPF5	2.4	32.0	946	0.091	0.022	ZCCHV_MOUSE Zinc finger CCCH-type antiviral protein 1 OS=Mus musculus OX=10090 GN=Zc3hav1 PE=1 SV=1
17	Q8K3Y6	2.4	31.6	776	0.091	0.027	ZCCHV_RAT Zinc finger CCCH-type antiviral protein 1 OS=Rattus norvegicus OX=10116 GN=Zc3hav1 PE=1 SV=1
18	Q4GZ09	2.7	31.6	732	0.113	0.036	Q4GZ09_TRYB2 Calpain, putative cysteine peptidase, Clan CA, family C2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2120 PE=4 SV=1
19	Q64385	4.1	30.8	432	0.126	0.067	I11RA_MOUSE Interleukin-11 receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Il11ra1 PE=1 SV=1
20	Q9FVJ3	5.2	30.4	337	0.109	0.074	AGD12_ARATH ADP-ribosylation factor GTPase-activating protein AGD12 OS=Arabidopsis thaliana OX=3702 GN=AGD12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15711 ILEI	1.3e-21	88.1	Interleukin-like EMT inducer

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000003025

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000009033	0.673	Coiled-coil domain containing 22
2	60711.ENSCSAP00000000036	0.557	Lysine--tRNA ligase
3	60711.ENSCSAP00000002175	0.514	Exosome component 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0002376	0.977	immune system process
GO:0065007	0.976	biological regulation
GO:0050789	0.962	regulation of biological process
GO:0009605	0.954	response to external stimulus
GO:0006955	0.917	immune response
GO:0048519	0.877	negative regulation of biological process
GO:0031347	0.856	regulation of defense response
GO:0009987	0.849	cellular process
GO:0002831	0.849	regulation of response to biotic stimulus
GO:0002682	0.838	regulation of immune system process
GO:0032101	0.838	regulation of response to external stimulus
GO:0009607	0.798	response to biotic stimulus
GO:0044419	0.796	biological process involved in interspecies interaction between organisms
GO:0050776	0.703	regulation of immune response
GO:1900150	0.691	regulation of defense response to fungus
GO:0006950	0.674	response to stress
GO:0002832	0.634	negative regulation of response to biotic stimulus
GO:0031348	0.632	negative regulation of defense response
GO:0006952	0.627	defense response
GO:0043207	0.624	response to external biotic stimulus
GO:0006959	0.590	humoral immune response
GO:0098542	0.588	defense response to other organism
GO:0050777	0.570	negative regulation of immune response
GO:0050794	0.491	regulation of cellular process
GO:0045088	0.478	regulation of innate immune response
GO:0009620	0.477	response to fungus
GO:0051716	0.322	cellular response to stimulus
GO:0032102	0.300	negative regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.989	endomembrane system
GO:0005737	0.989	cytoplasm
GO:0005576	0.960	extracellular region
GO:0070013	0.951	intracellular organelle lumen
GO:0005615	0.940	extracellular space
GO:0016020	0.931	membrane
GO:0031982	0.902	vesicle
GO:0031981	0.486	nuclear lumen
GO:0005829	0.480	cytosol
GO:0005794	0.337	Golgi apparatus
GO:0065010	0.328	extracellular membrane-bounded organelle
GO:1903561	0.315	extracellular vesicle
GO:0070062	0.305	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]