StarFunc result for job id P98174

User Input

>input (961 residues)
MHGHRAPGGAGPSEPEHPATNPPGAAPPACADSDPGASEPGLLARRGSGSALGGPLDPQF
VGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPG
QSLEPHPEGPQRLRSDPGPPTETPSQRPSPLKRAPGPKPQVPPKPSYLQMPRMPPPLEPI
PPPPSRPLPADPRVAKGLAPRAEASPSSAAVSSLIEKFEREPVIVASDRPVPGPSPGPPE
PVMLPQPTSQPPVPQLPEGEASRCLFLLAPGPRDGEKVPNRDSGIDSISSPSNSEETCFV
SDDGPPSHSLCPGPPALASVPVALADPHRPGSQEVDSDLEEEDDEEEEEEKDREIPVPLM
ERQESVELTVQQKVFHIANELLQTEKAYVSRLHLLDQVFCARLLEEARNRSSFPADVVHG
IFSNICSIYCFHQQFLLPELEKRMEEWDRYPRIGDILQKLAPFLKMYGEYVKNFDRAVEL
VNTWTERSTQFKVIIHEVQKEEACGNLTLQHHMLEPVQRIPRYELLLKDYLLKLPHGSPD
SKDAQKSLELIATAAEHSNAAIRKMERMHKLLKVYELLGGEEDIVSPTKELIKEGHILKL
SAKNGTTQDRYLILFNDRLLYCVPRLRLLGQKFSVRARIDVDGMELKESSNLNLPRTFLV
SGKQRSLELQARTEEEKKDWVQAINSTLLKHEQTLETFKLLNSTNREDEDTPPNSPNVDL
GKRAPTPIREKEVTMCMRCQEPFNSITKRRHHCKACGHVVCGKCSEFRARLVYDNNRSNR
VCTDCYVALHGVPGSSPACSQHTPQRRRSILEKQASVAAENSVICSFLHYMEKGGKGWHK
AWFVVPENEPLVLYIYGAPQDVKAQRSLPLIGFEVGPPEAGERPDRRHVFKITQSHLSWY
FSPETEELQRRWMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDK
T

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98174	1.000	1.000	0.000	961	1.000	1.000	P98174.pdb.gz	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
2	AFDB:Q8BY35	0.381	0.545	4.408E-62	655	0.322	0.472	Q8BY35.pdb.gz	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
3	AFDB:Q7Z6J4	0.380	0.544	2.663E-61	655	0.313	0.460	Q7Z6J4.pdb.gz	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
4	AFDB:Q6ZNL6	0.255	0.182	5.004E-39	1462	0.239	0.157	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
5	AFDB:Q54DW4	0.201	0.149	9.039E-23	1350	0.159	0.113	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
6	AFDB:Q54YZ6	0.211	0.174	8.310E-21	1218	0.134	0.106	Q54YZ6.pdb.gz	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
7	AFDB:Q96PE2	0.194	0.092	2.020E-18	2063	0.191	0.089	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
8	AFDB:Q12774	0.191	0.118	6.487E-18	1597	0.178	0.107	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
9	AFDB:Q8IQ97	0.194	0.149	7.741E-17	1311	0.156	0.114	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
10	PDB:7rx9A	0.207	0.426	1.615E-16	432	0.091	0.201	7rx9A.pdb.gz
11	PDB:4mt6A	0.234	0.467	2.757E-16	389	0.074	0.183	4mt6A.pdb.gz
12	AFDB:Q9Y7U6	0.223	0.172	1.122E-15	1334	0.160	0.115	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
13	PDB:4gouA	0.278	0.498	1.852E-10	507	0.059	0.112	4gouA.pdb.gz
14	PDB:3ljuX	0.121	0.249	1.119E-9	373	0.052	0.134	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
15	PDB:4mk0A	0.102	0.147	2.893E-5	631	0.043	0.065	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
16	PDB:6hhgA	0.088	0.208	3.188E-5	386	0.024	0.060	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:5yqrA	0.103	0.336	4.480E-5	268	0.025	0.090	5yqrA.pdb.gz
18	PDB:3pvuA	0.098	0.146	4.938E-5	609	0.041	0.064	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:6bbpA	0.099	0.168	6.939E-5	520	0.056	0.104	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
20	PDB:6s9wA	0.091	0.201	1.244E-4	411	0.027	0.063	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88387	0.0	664	766	0.333	0.418	FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Fgd4 PE=1 SV=1
2	O88842	0.0	626	733	0.355	0.465	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
3	P52734	0.0	1719	960	0.946	0.947	FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fgd1 PE=1 SV=2
4	P98174	0.0	1956	961	1.000	1.000	FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2
5	Q49A55	0.0	550	471	0.270	0.550	Q49A55_HUMAN FGD4 protein OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=1
6	Q5JSP0	0.0	631	725	0.352	0.466	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
7	Q7Z6J4	0.0	591	655	0.302	0.443	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
8	Q8BY35	0.0	590	655	0.304	0.446	FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Fgd2 PE=1 SV=1
9	Q91ZT5	0.0	667	766	0.353	0.443	FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus OX=10090 GN=Fgd4 PE=1 SV=1
10	Q96M96	0.0	663	766	0.338	0.424	FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FGD4 PE=1 SV=2
11	G5ECM5	1.44e-61	227	826	0.170	0.197	G5ECM5_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-5 PE=1 SV=1
12	G5ED03	1.66e-61	227	844	0.172	0.195	G5ED03_CAEEL Putative Rho guanine nucleotide exchange factor FGD-1 OS=Caenorhabditis elegans OX=6239 GN=fgd-1 PE=2 SV=1
13	A0A2X0SFF2	7.88e-61	229	1462	0.178	0.117	A0A2X0SFF2_HUMAN FGD5 (Fragment) OS=Homo sapiens OX=9606 GN=FGD5 PE=4 SV=1
14	Q6ZNL6	7.88e-61	229	1462	0.178	0.117	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
15	B7ZM68	7.99e-50	194	1178	0.163	0.133	B7ZM68_HUMAN FGD5 protein OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=1
16	Q91VS8	3.13e-43	173	1065	0.157	0.142	FARP2_MOUSE FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Mus musculus OX=10090 GN=Farp2 PE=1 SV=2
17	Q54DW7	4.25e-40	162	986	0.129	0.126	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
18	O94887	2.90e-37	154	1054	0.149	0.136	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
19	Q54YZ6	2.20e-26	119	1218	0.101	0.080	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
20	F1R6J2	4.41e-26	118	1622	0.104	0.062	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09026 CENP-B_dimeris	6e+02	12.3	Centromere protein B dimerisation domain
2	PF01363 FYVE	3.1e-12	57.8	FYVE zinc finger
3	PF02318 FYVE_2	0.37	22.4	FYVE-type zinc finger
4	PF00169 PH	2.3e-21	87.6	PH domain
5	PF15413 PH_11	27	16.7	Pleckstrin homology domain
6	PF08458 PH_2	2.4e+02	13.4	Plant pleckstrin homology-like region
7	PF15410 PH_9	57	15.3	Pleckstrin homology domain
8	PF00621 RhoGEF	7e-43	158.5	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364277

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.987	Cell division control protein 42 homolog
2	9606.ENSP00000365745	0.929	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
3	9606.ENSP00000364631	0.812	FYVE, RhoGEF and PH domain-containing protein 3
4	9606.ENSP00000360021	0.809	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
5	9606.ENSP00000259818	0.731	Tubulin beta-2B chain
6	9606.ENSP00000417653	0.698	Drebrin-like protein
7	9606.ENSP00000298694	0.666	Rho guanine nucleotide exchange factor 40
8	9606.ENSP00000347710	0.634	Oligophrenin-1
9	9606.ENSP00000315659	0.620	Dynamin-binding protein
10	9606.ENSP00000310491	0.618	Rho GTPase-activating protein 1
11	9606.ENSP00000341071	0.603	Rho guanine nucleotide exchange factor 3
12	9606.ENSP00000367355	0.574	Rho guanine nucleotide exchange factor 35
13	9606.ENSP00000297954	0.544	Serine/threonine-protein kinase WNK2
14	9606.ENSP00000298815	0.542	Rho GTPase-activating protein 42
15	9606.ENSP00000378338	0.520	ARF GTPase-activating protein GIT1
16	9606.ENSP00000348215	0.519	SH3 and PX domain-containing protein 2A
17	9606.ENSP00000438507	0.513	Uncharacterized protein
18	9606.ENSP00000347464	0.506	ARF GTPase-activating protein GIT2
19	9606.ENSP00000346667	0.503	Serine/threonine-protein kinase WNK3
20	9606.ENSP00000361027	0.502	Angiomotin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0051020	0.997	GTPase binding
GO:0031267	0.980	small GTPase binding
GO:0005543	0.313	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0048583	0.935	regulation of response to stimulus
GO:0016043	0.906	cellular component organization
GO:0009966	0.900	regulation of signal transduction
GO:1902531	0.872	regulation of intracellular signal transduction
GO:0051056	0.850	regulation of small GTPase mediated signal transduction
GO:0006996	0.712	organelle organization
GO:0007010	0.652	cytoskeleton organization
GO:0050896	0.625	response to stimulus
GO:0051716	0.562	cellular response to stimulus
GO:0007154	0.514	cell communication
GO:0023052	0.489	signaling
GO:0007165	0.430	signal transduction
GO:0022607	0.341	cellular component assembly
GO:0022604	0.333	regulation of cell morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.995	cytosol
GO:0012505	0.977	endomembrane system
GO:0043226	0.970	organelle
GO:0043229	0.962	intracellular organelle
GO:0043227	0.950	membrane-bounded organelle
GO:0043231	0.942	intracellular membrane-bounded organelle
GO:0071944	0.893	cell periphery
GO:0005886	0.882	plasma membrane
GO:0042995	0.542	cell projection
GO:0120025	0.470	plasma membrane bounded cell projection
GO:0031252	0.306	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]