StarFunc result for job id P98175

User Input

>input (930 residues)
MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS
SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED
EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH
LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK
SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND
TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL
QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG
GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP
EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ
SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA
QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR
SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD
RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL
SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG
ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG
ARGSSYGVTSTESYKETLHKTMVTRFNEAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4W4	0.283	0.283	0.000	930	1.000	1.000	A0A0S2Z4W4.pdb.gz	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
2	AFDB:S4R1W5	0.114	0.099	3.917E-34	1118	0.245	0.204	S4R1W5.pdb.gz	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
3	AFDB:P87143	0.112	0.166	4.401E-27	565	0.157	0.258	P87143.pdb.gz	YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A7.13 PE=4 SV=1
4	AFDB:O43719	0.090	0.109	7.258E-10	755	0.094	0.115	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
5	AFDB:Q63627	0.082	0.068	5.398E-9	1200	0.137	0.106	Q63627.pdb.gz	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
6	AFDB:O95104	0.081	0.070	8.780E-9	1147	0.127	0.103	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
7	PDB:7oqcF	0.095	0.286	8.384E-8	267	0.038	0.131	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
8	PDB:6y53o	0.081	0.419	3.834E-7	160	0.032	0.188	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
9	PDB:5vsuA	0.088	0.189	9.544E-7	387	0.041	0.098	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
10	PDB:5xjcw	0.086	0.786	3.030E-6	91	0.019	0.198	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
11	AFDB:Q92615	0.078	0.097	4.335E-6	738	0.122	0.153	Q92615.pdb.gz	LAR4B_HUMAN La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3
12	PDB:5lsbA	0.083	0.414	5.237E-6	176	0.025	0.131	5lsbA.pdb.gz
13	PDB:1hl6A	0.087	0.612	8.519E-6	119	0.022	0.168	1hl6A.pdb.gz
14	PDB:6r5kH	0.089	0.182	1.304E-5	394	0.051	0.119	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:6gd1A	0.083	0.386	1.386E-5	190	0.015	0.074	6gd1A.pdb.gz
16	PDB:3lqvB	0.080	0.588	1.472E-5	115	0.017	0.139	3lqvB.pdb.gz	Branch Recognition by SF3b14
17	PDB:6qx91K	0.088	0.379	1.565E-5	201	0.029	0.134	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	AFDB:Q8IGV1	0.093	0.089	1.982E-5	977	0.103	0.098	Q8IGV1.pdb.gz	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
19	AFDB:A0A0S2Z4Z0	0.078	0.107	2.106E-5	669	0.123	0.170	A0A0S2Z4Z0.pdb.gz	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
20	AFDB:Q1LY77	0.086	0.046	2.274E-3	1844	0.148	0.075	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4W4	0.0	1919	930	1.000	1.000	A0A0S2Z4W4_HUMAN RNA binding motif protein 10 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
2	A0A0S2Z4X1	0.0	1598	852	0.861	0.940	A0A0S2Z4X1_HUMAN Epididymis secretory sperm binding protein (Fragment) OS=Homo sapiens OX=9606 GN=RBM10 PE=2 SV=1
3	P52756	0.0	811	815	0.485	0.553	RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2
4	P70501	0.0	1553	852	0.835	0.912	RBM10_RAT RNA-binding protein 10 OS=Rattus norvegicus OX=10116 GN=Rbm10 PE=1 SV=1
5	P98175	0.0	1919	930	1.000	1.000	RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10 PE=1 SV=3
6	Q99KG3	0.0	1735	930	0.961	0.961	RBM10_MOUSE RNA-binding protein 10 OS=Mus musculus OX=10090 GN=Rbm10 PE=1 SV=1
7	Q8SZM4	1.96e-58	219	1004	0.177	0.164	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
8	Q9VPY4	2.81e-58	219	1004	0.177	0.164	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
9	P78332	1.18e-40	164	1123	0.137	0.113	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
10	Q3TPF1	8.58e-38	150	463	0.142	0.285	Q3TPF1_MOUSE RNA-binding protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=1
11	S4R1W5	1.88e-36	151	1118	0.138	0.114	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
12	Q3ULB0	2.29e-36	150	986	0.138	0.130	Q3ULB0_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
13	Q5DTS4	7.11e-36	149	1109	0.130	0.109	Q5DTS4_MOUSE MKIAA4015 protein (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=1
14	O88720	7.37e-36	149	1117	0.130	0.108	O88720_MOUSE RNA binding protein OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=2
15	F4JCU0	3.23e-21	102	1007	0.088	0.081	SUA_ARATH SUPPRESSOR OF ABI3-5 OS=Arabidopsis thaliana OX=3702 GN=SUA PE=1 SV=2
16	P87143	4.87e-18	91.3	565	0.067	0.110	YDMD_SCHPO Uncharacterized RNA-binding protein C57A7.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A7.13 PE=4 SV=1
17	A0A0A6YY54	2.63e-14	74.3	187	0.034	0.171	A0A0A6YY54_MOUSE RNA binding motif protein 6 (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
18	Q08CK9	2.08e-08	60.5	774	0.043	0.052	Q08CK9_DANRE Angiogenic factor with G patch and FHA domains 1 OS=Danio rerio OX=7955 GN=zgc:152959 PE=2 SV=1
19	Q9NW75	1.32e-07	57.8	528	0.028	0.049	GPTC2_HUMAN G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2 PE=1 SV=1
20	Q147M4	3.48e-07	55.5	301	0.030	0.093	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14362 DUF4407	2.8e+02	12.2	Domain of unknown function (DUF4407)
2	PF01585 G-patch	2.5e-15	67.4	G-patch domain
3	PF12656 G-patch_2	2.6e-05	35.5	G-patch domain
4	PF12437 GSIII_N	2.4e+02	12.6	Glutamine synthetase type III N terminal
5	PF17780 OCRE	3.8e-15	67.0	OCRE domain
6	PF00076 RRM_1	1.2e-09	49.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
7	PF18551 TackOD1	4.2e+02	12.0	Thaumarchaeal output domain 1
8	PF13894 zf-C2H2_4	8.7e+02	12.2	C2H2-type zinc finger
9	PF00641 zf-RanBP	0.0025	28.4	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003809715.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003828633.1	0.765	Splicing factor 1 isoform X1
2	9597.XP_008963643.1	0.737	Serrate RNA effector molecule homolog isoform X1
3	9597.XP_008957394.1	0.707	U2 small nuclear RNA auxiliary factor 2
4	9597.XP_003826881.1	0.694	DEAH-box helicase 15
5	9597.XP_003811291.1	0.690	Rho GTPase-activating protein 24 isoform X1
6	9597.XP_008960192.1	0.686	Belongs to the ubiquitin-activating E1 family.
7	9597.XP_003824269.1	0.684	Myb like, SWIRM and MPN domains 1
8	9597.XP_008960221.1	0.683	Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes.
9	9597.XP_008967283.1	0.682	Cell division cycle and apoptosis regulator 1
10	9597.XP_003818419.1	0.666	Deubiquitinating enzyme that removes conjugated ubiquitin from specific proteins to regulate different cellular processes.
11	9597.XP_008950158.1	0.662	U2 snRNP associated SURP domain containing
12	9597.XP_008972747.1	0.651	Papillary renal cell carcinoma (translocation-associated)
13	9597.XP_003809221.1	0.647	Heterogeneous nuclear ribonucleoprotein K
14	9597.XP_008958790.1	0.627	Polypyrimidine tract binding protein 2
15	9597.XP_003810375.1	0.616	DEAQ-box RNA dependent ATPase 1
16	9597.XP_003816331.1	0.616	DEAH-box helicase 32 (putative)
17	9597.XP_003832938.1	0.610	KRR1 small subunit processome component homolog
18	9597.XP_003807295.1	0.603	G-patch domain and KOW motifs
19	9597.XP_003821096.1	0.586	G-patch domain containing 4
20	9597.XP_003810023.1	0.585	Heterogeneous nuclear ribonucleoprotein M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003677	0.645	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043489	0.997	RNA stabilization
GO:1902373	0.997	negative regulation of mRNA catabolic process
GO:0009987	0.990	cellular process
GO:0048255	0.982	mRNA stabilization
GO:0050684	0.973	regulation of mRNA processing
GO:0048522	0.971	positive regulation of cellular process
GO:0042981	0.960	regulation of apoptotic process
GO:0009889	0.925	regulation of biosynthetic process
GO:0043484	0.916	regulation of RNA splicing
GO:0010556	0.910	regulation of macromolecule biosynthetic process
GO:0031326	0.905	regulation of cellular biosynthetic process
GO:0006355	0.769	regulation of DNA-templated transcription
GO:0071704	0.737	organic substance metabolic process
GO:0044238	0.711	primary metabolic process
GO:0043170	0.680	macromolecule metabolic process
GO:0006807	0.675	nitrogen compound metabolic process
GO:0043068	0.657	positive regulation of programmed cell death
GO:0010558	0.652	negative regulation of macromolecule biosynthetic process
GO:0031327	0.645	negative regulation of cellular biosynthetic process
GO:0048024	0.559	regulation of mRNA splicing, via spliceosome
GO:0044237	0.552	cellular metabolic process
GO:0006357	0.516	regulation of transcription by RNA polymerase II
GO:1902679	0.510	negative regulation of RNA biosynthetic process
GO:0043065	0.469	positive regulation of apoptotic process
GO:1903507	0.443	negative regulation of nucleic acid-templated transcription
GO:0034641	0.428	cellular nitrogen compound metabolic process
GO:0046483	0.427	heterocycle metabolic process
GO:1901360	0.425	organic cyclic compound metabolic process
GO:0045892	0.424	negative regulation of DNA-templated transcription
GO:0090304	0.415	nucleic acid metabolic process
GO:0016070	0.389	RNA metabolic process
GO:0042127	0.364	regulation of cell population proliferation
GO:0010467	0.364	gene expression
GO:0000122	0.356	negative regulation of transcription by RNA polymerase II
GO:0006396	0.347	RNA processing
GO:0010629	0.342	negative regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.996	nuclear speck
GO:0032991	0.984	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]