StarFunc result for job id P98177

User Input

>input (505 residues)
MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHT
EGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEK
RLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWML
NPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSG
SPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL
NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCF
SSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLE
CDMDNIISDLMDEGEGLDFNFEPDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98177	0.999	0.999	1.090E-76	505	1.000	1.000	P98177.pdb.gz	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
2	AFDB:D4A433	0.260	0.260	5.748E-65	505	0.881	0.881	D4A433.pdb.gz	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
3	AFDB:Q5I0F7	0.269	0.221	1.022E-31	643	0.467	0.367	Q5I0F7.pdb.gz	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
4	AFDB:B3DGQ4	0.233	0.186	9.587E-29	651	0.446	0.346	B3DGQ4.pdb.gz
5	AFDB:O73862	0.157	0.184	5.057E-11	420	0.178	0.214	O73862.pdb.gz	O73862_DANRE Forkhead box protein G1 OS=Danio rerio OX=7955 GN=BF-1 PE=2 SV=1
6	AFDB:P85037	0.160	0.113	5.057E-11	733	0.222	0.153	P85037.pdb.gz	FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1
7	AFDB:Q5AS72	0.154	0.111	1.089E-9	717	0.220	0.155	Q5AS72.pdb.gz	Q5AS72_EMENI Forkhead transcription factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08858 PE=4 SV=1
8	AFDB:Q9DBY0	0.153	0.100	3.031E-9	795	0.176	0.112	Q9DBY0.pdb.gz	FOXP4_MOUSE Forkhead box protein P4 OS=Mus musculus OX=10090 GN=Foxp4 PE=1 SV=1
9	AFDB:B3DH11	0.160	0.145	1.320E-5	565	0.182	0.163	B3DH11.pdb.gz
10	PDB:2hdcA	0.139	0.582	1.471E-5	97	0.075	0.392	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
11	AFDB:Q9EQY1	0.123	0.120	4.449E-3	524	0.170	0.164	Q9EQY1.pdb.gz
12	PDB:6qpqD	0.122	0.566	2.026E-2	82	0.022	0.134	6qpqD.pdb.gz
13	PDB:7k5yU	0.118	0.620	6.009E-2	75	0.028	0.187	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
14	PDB:6zmiCE	0.114	0.673	6.405E-2	72	0.018	0.125	6zmiCE.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
15	PDB:2qbyB	0.114	0.150	9.402E-2	368	0.024	0.033	2qbyB.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
16	PDB:6i6mB	0.116	0.155	1.214E-1	357	0.020	0.028	6i6mB.pdb.gz	Structure of Papaver somniferum O-Methyltransferase 1 Reveals Initiation of Noscapine Biosynthesis with Implications for Plant Natural Product Methylation
17	PDB:6iwtA	0.101	0.137	1.214E-1	346	0.024	0.035	6iwtA.pdb.gz
18	PDB:6labV	0.122	0.414	1.380E-1	109	0.036	0.165	6labV.pdb.gz	Engineering nucleosomes for generating diverse chromatin assemblies.
19	PDB:3euhC	0.126	0.276	1.471E-1	206	0.024	0.058	3euhC.pdb.gz
20	PDB:5xohA	0.102	0.138	1.471E-1	348	0.020	0.029	5xohA.pdb.gz	Crystal structure of bergaptol o-methyltransferase complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MJF0	0.0	670	450	0.693	0.778	A0A096MJF0_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=2
2	D4A433	0.0	845	505	0.883	0.883	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
3	P98177	0.0	1009	505	1.000	1.000	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
4	Q9WVH3	0.0	892	505	0.885	0.885	FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus OX=10090 GN=Foxo4 PE=1 SV=1
5	Q5I0F7	1.68e-97	310	643	0.469	0.369	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
6	Q9W7F8	5.70e-95	303	651	0.444	0.344	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
7	D3ZBQ1	2.14e-94	302	672	0.412	0.310	D3ZBQ1_RAT Forkhead box O3 OS=Rattus norvegicus OX=10116 GN=Foxo3 PE=1 SV=1
8	F1NNE8	4.31e-93	298	660	0.408	0.312	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
9	Q9WVH4	1.55e-92	297	672	0.400	0.301	FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus OX=10090 GN=Foxo3 PE=1 SV=1
10	G3V7R4	9.86e-92	295	649	0.412	0.320	FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus OX=10116 GN=Foxo1 PE=1 SV=1
11	A3RK75	1.61e-91	293	629	0.345	0.277	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
12	Q9R1E0	8.92e-91	292	652	0.410	0.317	FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus OX=10090 GN=Foxo1 PE=1 SV=2
13	Q12778	1.07e-90	292	655	0.412	0.318	FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2
14	F1RME6	1.26e-90	292	662	0.414	0.316	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
15	A4L7N3	2.37e-90	291	662	0.414	0.316	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
16	O43524	2.59e-89	289	673	0.341	0.256	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
17	A3RK74	6.14e-87	282	652	0.301	0.233	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
18	A8MYZ6	1.40e-74	245	492	0.255	0.262	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
19	Q95V55	1.94e-63	219	613	0.263	0.217	FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster OX=7227 GN=foxo PE=1 SV=1
20	B3G3K1	1.40e-48	178	584	0.192	0.166	B3G3K1_ANCCA Forkhead transcription factor DAF-16 OS=Ancylostoma caninum OX=29170 GN=daf16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1e-22	91.4	Forkhead domain
2	PF16676 FOXO-TAD	8.9e-14	63.0	Transactivation domain of FOXO protein family
3	PF16675 FOXO_KIX_bdg	0.0087	27.6	KIX-binding domain of forkhead box O, CR2
4	PF01342 SAND	4.4e+02	12.1	SAND domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
2	9606.ENSP00000258149	0.993	E3 ubiquitin-protein ligase Mdm2
3	9606.ENSP00000212015	0.992	NAD-dependent protein deacetylase sirtuin-1
4	9606.ENSP00000451828	0.990	RAC-alpha serine/threonine-protein kinase
5	9606.ENSP00000262367	0.980	CREB-binding protein
6	9606.ENSP00000343535	0.978	Ubiquitin carboxyl-terminal hydrolase 7
7	9606.ENSP00000379287	0.972	14-3-3 protein zeta/delta
8	9606.ENSP00000344456	0.970	Catenin beta-1
9	9606.ENSP00000336712	0.966	Transportin-1
10	9606.ENSP00000376943	0.961	Bcl-2-like protein 11
11	9606.ENSP00000428205	0.959	F-box only protein 32
12	9606.ENSP00000478320	0.956	Ataxin-3
13	9606.ENSP00000361021	0.955	Phosphatase and tensin homolog
14	9606.ENSP00000306330	0.953	14-3-3 protein gamma
15	9606.ENSP00000375892	0.953	RAC-beta serine/threonine-protein kinase
16	9606.ENSP00000228872	0.951	Cyclin-dependent kinase inhibitor 1B
17	9606.ENSP00000380432	0.949	Insulin
18	9606.ENSP00000332973	0.948	Mothers against decapentaplegic homolog 3
19	9606.ENSP00000384863	0.947	Exportin-1
20	9606.ENSP00000262160	0.945	Mothers against decapentaplegic homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0003682	0.996	chromatin binding
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0019899	0.994	enzyme binding
GO:0000981	0.994	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.985	transcription factor binding
GO:0001228	0.979	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.957	identical protein binding
GO:0140297	0.952	DNA-binding transcription factor binding
GO:0008013	0.850	beta-catenin binding
GO:1990841	0.772	promoter-specific chromatin binding
GO:0000977	0.385	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0006950	0.987	response to stress
GO:0048518	0.982	positive regulation of biological process
GO:0048519	0.975	negative regulation of biological process
GO:0048523	0.971	negative regulation of cellular process
GO:0010557	0.971	positive regulation of macromolecule biosynthetic process
GO:0032502	0.970	developmental process
GO:0031328	0.970	positive regulation of cellular biosynthetic process
GO:0007154	0.966	cell communication
GO:0023052	0.940	signaling
GO:0006355	0.939	regulation of DNA-templated transcription
GO:0051173	0.904	positive regulation of nitrogen compound metabolic process
GO:0051716	0.894	cellular response to stimulus
GO:0045935	0.836	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.791	positive regulation of DNA-templated transcription
GO:0007568	0.773	aging
GO:0007165	0.765	signal transduction
GO:0030334	0.746	regulation of cell migration
GO:0042221	0.695	response to chemical
GO:0006357	0.661	regulation of transcription by RNA polymerase II
GO:0070887	0.642	cellular response to chemical stimulus
GO:0014910	0.636	regulation of smooth muscle cell migration
GO:0010033	0.627	response to organic substance
GO:0051239	0.590	regulation of multicellular organismal process
GO:0042127	0.526	regulation of cell population proliferation
GO:0035902	0.514	response to immobilization stress
GO:0045944	0.502	positive regulation of transcription by RNA polymerase II
GO:0007166	0.499	cell surface receptor signaling pathway
GO:0035556	0.462	intracellular signal transduction
GO:0050793	0.461	regulation of developmental process
GO:0071310	0.460	cellular response to organic substance
GO:0033554	0.450	cellular response to stress
GO:0008152	0.443	metabolic process
GO:0009892	0.436	negative regulation of metabolic process
GO:0071495	0.405	cellular response to endogenous stimulus
GO:1901701	0.404	cellular response to oxygen-containing compound
GO:0071704	0.403	organic substance metabolic process
GO:0045595	0.396	regulation of cell differentiation
GO:0048856	0.384	anatomical structure development
GO:0009605	0.381	response to external stimulus
GO:0032501	0.379	multicellular organismal process
GO:0010605	0.365	negative regulation of macromolecule metabolic process
GO:0031324	0.362	negative regulation of cellular metabolic process
GO:0051172	0.361	negative regulation of nitrogen compound metabolic process
GO:0009991	0.356	response to extracellular stimulus
GO:0048583	0.354	regulation of response to stimulus
GO:0044238	0.319	primary metabolic process
GO:0044237	0.307	cellular metabolic process
GO:0030335	0.305	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.455	protein-containing complex
GO:0016604	0.393	nuclear body
GO:0016607	0.318	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]