StarFunc result for job id P98182

User Input

>input (395 residues)
MMAAKVVPMPPKPKQSFILRVPPDSKLGQDLLRDATNGPKTIHQLVLEHFLTFLPKPSLV
QPSQKVKETLVIMKDVSSSLQNRVHPRPLVKLLPKGVQKEQETVSLYLKANPEELVVFED
LNVFHCQEECVSLDPTQQLTSEKEDDSSVGEMMLLAVNGSNPEGEDPEREPVENEDYREK
SSDDDEMDSSLVSQQPPDNQEKERLNTSIPQKRKMRNLLVTIENDTPLEELSKYVDISII
ALTRNRRTRRWYTCPLCGKQFNESSYLISHQRTHTGEKPYDCNHCGKSFNHKTNLNKHER
IHTGEKPYSCSQCGKNFRQNSHRSRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEA
ERPYGCKKCGRRFGRLSNCTRHEKTHSACKTRKQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P98182	1.000	1.000	1.775E-64	395	1.000	1.000	P98182.pdb.gz	ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens OX=9606 GN=ZNF200 PE=1 SV=2
2	AFDB:Q96N58	0.325	0.222	1.005E-18	590	0.263	0.176	Q96N58.pdb.gz	ZN578_HUMAN Zinc finger protein 578 OS=Homo sapiens OX=9606 GN=ZNF578 PE=1 SV=2
3	AFDB:Q8TF45	0.330	0.200	1.370E-18	676	0.253	0.148	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
4	AFDB:Q9H707	0.321	0.313	1.988E-18	407	0.266	0.258	Q9H707.pdb.gz	ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens OX=9606 GN=ZNF552 PE=1 SV=2
5	AFDB:Q8NF99	0.329	0.247	2.115E-18	534	0.284	0.210	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
6	AFDB:Q86UD4	0.324	0.243	2.548E-18	541	0.271	0.198	Q86UD4.pdb.gz	ZN329_HUMAN Zinc finger protein 329 OS=Homo sapiens OX=9606 GN=ZNF329 PE=1 SV=2
7	AFDB:Q86W11	0.312	0.253	2.548E-18	494	0.238	0.190	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
8	AFDB:Q6ZS27	0.322	0.301	3.475E-18	426	0.263	0.244	Q6ZS27.pdb.gz	ZN662_HUMAN Zinc finger protein 662 OS=Homo sapiens OX=9606 GN=ZNF662 PE=1 SV=1
9	AFDB:I3L4J6	0.328	0.300	3.934E-18	435	0.281	0.255	I3L4J6.pdb.gz	I3L4J6_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
10	AFDB:Q9EQB9	0.335	0.183	3.934E-18	759	0.316	0.165	Q9EQB9.pdb.gz	ZN287_MOUSE Zinc finger protein 287 OS=Mus musculus OX=10090 GN=Znf287 PE=2 SV=2
11	PDB:3w5kB	0.113	0.258	5.328E-5	110	0.099	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5dkaA	0.064	0.180	1.025	96	0.028	0.115	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
13	PDB:6gejS	0.056	0.103	1.314	208	0.081	0.154	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:6hivA5	0.055	0.207	5.825	55	0.020	0.145	6hivA5.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
15	PDB:7w59R	0.081	0.105	5.825	280	0.111	0.157	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:6ke6A8	0.065	0.050	6.197	548	0.053	0.038	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
17	PDB:2qzvA	0.056	0.033	7.016	749	0.035	0.019	2qzvA.pdb.gz
18	PDB:3vw7A	0.047	0.043	7.465	442	0.013	0.011	3vw7A.pdb.gz	High-resolution crystal structure of human protease-activated receptor 1
19	PDB:5gm6a	0.050	0.123	7.465	123	0.046	0.146	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:6zdbA	0.059	0.133	7.465	129	0.046	0.140	6zdbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P98182	0.0	817	395	1.000	1.000	ZN200_HUMAN Zinc finger protein 200 OS=Homo sapiens OX=9606 GN=ZNF200 PE=1 SV=2
2	Q96LX8	3.74e-51	179	424	0.266	0.248	ZN597_HUMAN Zinc finger protein 597 OS=Homo sapiens OX=9606 GN=ZNF597 PE=1 SV=1
3	Q8N184	3.20e-46	169	647	0.190	0.116	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
4	P17036	9.46e-45	162	446	0.271	0.240	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
5	Q86U76	1.04e-44	161	410	0.271	0.261	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
6	Q6AZW8	1.85e-44	158	331	0.187	0.224	ZN660_HUMAN Zinc finger protein 660 OS=Homo sapiens OX=9606 GN=ZNF660 PE=1 SV=1
7	Q9UNY5	1.45e-43	158	417	0.281	0.266	ZN232_HUMAN Zinc finger protein 232 OS=Homo sapiens OX=9606 GN=ZNF232 PE=1 SV=1
8	P17029	4.86e-43	160	563	0.177	0.124	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
9	Q8NF99	2.39e-42	157	534	0.185	0.137	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
10	Q6ECI4	3.98e-42	159	717	0.177	0.098	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	Q9HBT8	5.38e-42	156	521	0.177	0.134	Z286A_HUMAN Zinc finger protein 286A OS=Homo sapiens OX=9606 GN=ZNF286A PE=1 SV=1
12	A0JPL0	7.30e-42	156	549	0.187	0.135	ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus OX=10116 GN=Znf382 PE=1 SV=1
13	P17023	7.47e-42	154	458	0.243	0.210	ZNF19_HUMAN Zinc finger protein 19 OS=Homo sapiens OX=9606 GN=ZNF19 PE=1 SV=4
14	P52742	9.03e-42	157	658	0.182	0.109	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
15	Q9UJW8	1.07e-41	157	692	0.180	0.103	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
16	P49910	1.74e-41	154	485	0.170	0.138	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
17	Q53Z40	1.74e-41	154	485	0.170	0.138	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
18	Q8NA42	2.06e-41	154	475	0.177	0.147	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
19	Q15776	2.31e-41	155	578	0.182	0.125	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
20	Q9C0F3	2.77e-41	153	470	0.180	0.151	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10915 DUF2709	20	15.9	Protein of unknown function (DUF2709)
2	PF11310 DUF3113	2.4e+02	13.1	Protein of unknown function (DUF3113)
3	PF19108 DUF5795	5.9e+02	11.8	Family of unknown function (DUF5795)
4	PF12773 DZR	2.2	19.7	Double zinc ribbon
5	PF01155 HypA	7.8e+02	11.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
6	PF01352 KRAB	11	17.1	KRAB box
7	PF14149 YhfH	71	14.8	YhfH-like protein
8	PF00096 zf-C2H2	4.9e-19	78.8	Zinc finger, C2H2 type
9	PF18868 zf-C2H2_3rep	3.8e+02	13.2	Zinc finger C2H2-type, 3 repeats
10	PF13894 zf-C2H2_4	3.6e-11	53.9	C2H2-type zinc finger
11	PF13912 zf-C2H2_6	1	20.7	C2H2-type zinc finger
12	PF12171 zf-C2H2_jaz	0.44	22.1	Zinc-finger double-stranded RNA-binding
13	PF13913 zf-C2HC_2	22	16.4	zinc-finger of a C2HC-type
14	PF05605 zf-Di19	10	17.8	Drought induced 19 protein (Di19), zinc-binding
15	PF13465 zf-H2C2_2	2.4e-24	95.9	Zinc-finger double domain
16	PF12874 zf-met	0.58	21.8	Zinc-finger of C2H2 type
17	PF18439 zf_UBZ	0.038	24.9	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	0.033	26.3	zinc-ribbon family
19	PF14369 zinc_ribbon_9	48	15.6	zinc-ribbon
20	PF18112 Zn-C2H2_12	40	16.0	Autophagy receptor zinc finger-C2H2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305424	0.769	Olfactory receptor 1F1
2	9606.ENSP00000364678	0.762	Histone-lysine N-methyltransferase EHMT2
3	9606.ENSP00000219596	0.652	Pyrin
4	9606.ENSP00000275300	0.613	Solute carrier family 22 member 3
5	9606.ENSP00000355920	0.610	Solute carrier family 22 member 2
6	9606.ENSP00000380071	0.594	Tigger transposable element-derived protein 7
7	9606.ENSP00000392335	0.556	Putative zinc finger protein 487
8	9606.ENSP00000479904	0.548	Zinc finger MYM-type protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.974	regulation of metabolic process
GO:0009987	0.952	cellular process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0010468	0.917	regulation of gene expression
GO:0031323	0.796	regulation of cellular metabolic process
GO:0006355	0.737	regulation of DNA-templated transcription
GO:0071840	0.646	cellular component organization or biogenesis
GO:0016043	0.638	cellular component organization
GO:0048519	0.593	negative regulation of biological process
GO:0032501	0.567	multicellular organismal process
GO:0010605	0.513	negative regulation of macromolecule metabolic process
GO:0071704	0.431	organic substance metabolic process
GO:0048523	0.418	negative regulation of cellular process
GO:0050896	0.405	response to stimulus
GO:0006807	0.389	nitrogen compound metabolic process
GO:0044238	0.382	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0043232	0.938	intracellular non-membrane-bounded organelle
GO:0032991	0.640	protein-containing complex
GO:0005737	0.553	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]