StarFunc result for job id P98196

User Input

>input (1134 residues)
MDCSLVRTLVHRYCAGEENWVDSRTIYVGHREPPPGAEAYIPQRYPDNRIVSSKYTFWNF
IPKNLFEQFRRVANFYFLIIFLVQLIIDTPTSPVTSGLPLFFVITVTAIKQGYEDWLRHK
ADNAMNQCPVHFIQHGKLVRKQSRKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTT
ASLDGESSHKTHYAVQDTKGFHTEEDIGGLHATIECEQPQPDLYKFVGRINVYSDLNDPV
VRPLGSENLLLRGATLKNTEKIFGVAIYTGMETKMALNYQSKSQKRSAVEKSMNAFLIVY
LCILISKALINTVLKYMWQSEPFRDEPWYNQKTESERQRNLFLKAFTDFLAFMVLFNYII
PVSMYVTVEMQKFLGSYFITWDEDMFDEETGEGPLVNTSDLNEELGQVEYIFTDKTGTLT
ENNMEFKECCIEGHVYVPHVICNGQVLPESSGIDMIDSSPSVNGREREELFFRALCLCHT
VQVKDDDSVDGPRKSPDGGKSCVYISSSPDEVALVEGVQRLGFTYLRLKDNYMEILNREN
HIERFELLEILSFDSVRRRMSVIVKSATGEIYLFCKGADSSIFPRVIEGKVDQIRARVER
NAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLGATA
VEDRLQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEE
QSLHDVLFELSKTVLRHSGSLTRDNLSGLSADMQDYGLIIDGAALSLIMKPREDGSSGNY
RELFLEICRSCSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGI
GVIGKEGRQAARNSDYAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLY
QFFCGFSQQTLYDTAYLTLYNISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALL
RWRVFIYWTLLGLFDALVFFFGAYFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKL
ALDTHYWTWINHFVIWGSLLFYVVFSLLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIV
LLVTISLLPDVLKKVLCRQLWPTATERVQTKSQCLSVEQSTIFMLSQTSSSLSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7bspA	0.737	0.804	0.000	1028	0.616	0.679	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
2	AFDB:E9PEJ6	0.942	0.898	0.000	1191	0.978	0.931	E9PEJ6.pdb.gz	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
3	AFDB:Q8NB49	0.916	0.918	0.000	1132	0.634	0.635	Q8NB49.pdb.gz	AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens OX=9606 GN=ATP11C PE=1 SV=3
4	AFDB:Q9Y2G3	0.921	0.887	0.000	1177	0.579	0.558	Q9Y2G3.pdb.gz	AT11B_HUMAN Phospholipid-transporting ATPase IF OS=Homo sapiens OX=9606 GN=ATP11B PE=1 SV=2
5	PDB:6lknA	0.830	0.881	6.652E-97	1064	0.619	0.660	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
6	AFDB:Q9XIE6	0.871	0.816	6.005E-95	1213	0.367	0.343	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
7	AFDB:Q9NTI2	0.878	0.839	2.631E-93	1188	0.360	0.343	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
8	AFDB:P70704	0.856	0.835	4.459E-93	1164	0.365	0.356	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
9	AFDB:Q9SAF5	0.870	0.822	1.374E-91	1203	0.359	0.338	Q9SAF5.pdb.gz	ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana OX=3702 GN=ALA11 PE=2 SV=1
10	AFDB:F4IE35	0.859	0.823	2.133E-91	1185	0.355	0.340	F4IE35.pdb.gz	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
11	AFDB:P98198	0.867	0.815	2.229E-91	1209	0.350	0.328	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
12	AFDB:Q8TF62	0.859	0.818	3.947E-91	1192	0.337	0.320	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
13	PDB:7bssA	0.639	0.868	8.970E-81	816	0.504	0.701	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
14	PDB:7kycA	0.847	0.816	1.369E-79	1178	0.330	0.317	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7py4A	0.817	0.833	2.765E-79	1112	0.326	0.333	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
16	PDB:6rohA	0.842	0.858	3.761E-79	1112	0.348	0.355	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
17	PDB:7kyaA	0.844	0.816	9.990E-77	1174	0.317	0.307	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
18	PDB:7vghB	0.834	0.801	1.620E-76	1183	0.327	0.314	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
19	PDB:6k7lA	0.797	0.907	2.726E-73	992	0.338	0.386	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
20	PDB:7rd6A	0.734	0.888	2.695E-62	929	0.246	0.300	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW70	638	1190	0.353	0.336	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
2	A0A8I5ZKC1	599	985	0.323	0.372	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
3	A0A8I5ZXX6	696	1164	0.375	0.365	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I6AVY6	699	1164	0.374	0.364	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6G2I8	598	978	0.322	0.373	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A3FIN4	607	1183	0.342	0.328	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
7	C7EXK4	670	1148	0.370	0.366	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
8	D4A3X6	668	1169	0.368	0.357	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
9	D4AA47	622	1251	0.345	0.313	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
10	E9PEJ6	2309	1191	0.978	0.931	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
11	F1LUT4	598	984	0.323	0.372	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
12	F4IE35	681	1185	0.361	0.345	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
13	H0Y547	1930	935	0.818	0.993	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
14	O43520	615	1251	0.344	0.312	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
15	O94296	633	1258	0.340	0.307	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
16	P39524	648	1355	0.354	0.297	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
17	P70704	689	1164	0.371	0.362	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
18	P98196	2361	1134	1.000	1.000	AT11A_HUMAN Phospholipid-transporting ATPase IH OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=3
19	P98197	2182	1187	0.921	0.880	AT11A_MOUSE Phospholipid-transporting ATPase IH OS=Mus musculus OX=10090 GN=Atp11a PE=1 SV=1
20	P98198	637	1209	0.353	0.331	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	1.2e-07	43.0	Cation transport ATPase (P-type)
2	PF00122 E1-E2_ATPase	4.3e-07	41.2	E1-E2 ATPase
3	PF19962 EAD9	7.9e+02	11.2	Effector-associated domain 9
4	PF12710 HAD	1e+02	14.8	haloacid dehalogenase-like hydrolase
5	PF00702 Hydrolase	7.9e-08	44.4	haloacid dehalogenase-like hydrolase
6	PF08282 Hydrolase_3	1.7	19.9	haloacid dehalogenase-like hydrolase
7	PF16212 PhoLip_ATPase_C	7.3e-74	260.2	Phospholipid-translocating P-type ATPase C-terminal
8	PF16209 PhoLip_ATPase_N	6.7e-19	78.7	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420387

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.875	Cell cycle control protein 50A
2	9606.ENSP00000450842	0.731	Cell cycle control protein 50B
3	9606.ENSP00000419663	0.721	Cell cycle control protein 50C
4	9606.ENSP00000332488	0.617	Signal peptide peptidase-like 2C
5	9606.ENSP00000218008	0.604	Protein ATP1B4
6	9606.ENSP00000262960	0.564	Dipeptidyl peptidase 9
7	9606.ENSP00000264344	0.561	Protein FAM13A
8	9606.ENSP00000273963	0.558	Kelch-like protein 8
9	9606.ENSP00000362991	0.547	XK-related protein 8
10	9606.ENSP00000419361	0.537	Adenylate cyclase type 5
11	9606.ENSP00000261965	0.525	Gamma-tubulin complex component 3
12	9606.ENSP00000351770	0.525	Forkhead-associated domain-containing protein 1
13	9606.ENSP00000224950	0.517	CST complex subunit STN1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005548	1.000	phospholipid transporter activity
GO:0140327	1.000	flippase activity
GO:0140333	0.972	glycerophospholipid flippase activity
GO:0140346	0.469	phosphatidylserine flippase activity
GO:0008525	0.350	phosphatidylcholine transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.985	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0065008	0.852	regulation of biological quality
GO:0048522	0.784	positive regulation of cellular process
GO:0071840	0.740	cellular component organization or biogenesis
GO:0051149	0.739	positive regulation of muscle cell differentiation
GO:0016043	0.729	cellular component organization
GO:0051179	0.683	localization
GO:0010830	0.674	regulation of myotube differentiation
GO:0051234	0.627	establishment of localization
GO:0006810	0.561	transport
GO:0061024	0.470	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.966	membrane
GO:0005886	0.903	plasma membrane
GO:0032991	0.851	protein-containing complex
GO:0005794	0.833	Golgi apparatus
GO:0031090	0.807	organelle membrane
GO:0031982	0.664	vesicle
GO:0031410	0.461	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]