StarFunc result for job id P98198

User Input

>input (1209 residues)
MTVPKEMPEKWARAQAPPSWSRKKPSWGTEEERRARANDREYNEKFQYASNCIKTSKYNI
LTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVPLVLVLTITAVKDATDDY
FRHKSDNQVNNRQSQVLINGILQQEQWMNVCVGDIIKLENNQFVAADLLLLSSSEPHGLC
YIETAELDGETNMKVRQAIPVTSELGDISKLAKFDGEVICEPPNNKLDKFSGTLYWKENK
FPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSIDRLMNTLVLWIF
GFLVCMGVILAIGNAIWEHEVGMRFQVYLPWDEAVDSAFFSGFLSFWSYIIILNTVVPIS
LYVSVEVIRLGHSYFINWDKKMFCMKKRTPAEARTTTLNEELGQVEYIFSDKTGTLTQNI
MVFNKCSINGHSYGDVFDVLGHKAELGERPEPVDFSFNPLADKKFLFWDPSLLEAVKIGD
PHTHEFFRLLSLCHTVMSEEKNEGELYYKAQSPDEGALVTAARNFGFVFRSRTPKTITVH
EMGTAITYQLLAILDFNNIRKRMSVIVRNPEGKIRLYCKGADTILLDRLHHSTQELLNTT
MDHLNEYAGEGLRTLVLAYKDLDEEYYEEWAERRLQASLAQDSREDRLASIYEEVENNMM
LLGATAIEDKLQQGVPETIALLTLANIKIWVLTGDKQETAVNIGYSCKMLTDDMTEVFIV
TGHTVLEVREELRKAREKMMDSSRSVGNGFTYQDKLSSSKLTSVLEAVAGEYALVINGHS
LAHALEADMELEFLETACACKAVICCRVTPLQKAQVVELVKKYKKAVTLAIGDGANDVSM
IKTAHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLLVHGRWSYLRMCKFLCYFFYKNFA
FTMVHFWFGFFCGFSAQTVYDQYFITLYNIVYTSLPVLAMGVFDQDVPEQRSMEYPKLYE
PGQLNLLFNKREFFICIAQGIYTSVLMFFIPYGVFADATRDDGTQLADYQSFAVTVATSL
VIVVSVQIGLDTGYWTAINHFFIWGSLAVYFAILFAMHSNGLFDMFPNQFRFVGNAQNTL
AQPTVWLTIVLTTVVCIMPVVAFRFLRLNLKPDLSDTVRYTQLVRKKQKAQHRCMRRVGR
TGSRRSGYAFSHQEGFGELIMSGKNMRLSSLALSSFTTRSSSSWIESLRRKKSDSASSPS
GGADKPLKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7py4A	0.855	0.927	0.000	1112	0.514	0.558	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
2	AFDB:A3FIN4	0.919	0.939	0.000	1183	0.563	0.576	A3FIN4.pdb.gz	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
3	AFDB:D4AA47	0.871	0.842	0.000	1251	0.529	0.512	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
4	AFDB:P98198	1.000	1.000	0.000	1209	1.000	1.000	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
5	AFDB:Q6UQ17	0.848	0.770	0.000	1335	0.438	0.396	Q6UQ17.pdb.gz	AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus OX=10090 GN=Atp8b3 PE=1 SV=1
6	AFDB:Q7YXV5	0.899	0.857	0.000	1270	0.546	0.520	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
7	AFDB:Q8TF62	0.929	0.942	0.000	1192	0.693	0.703	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
8	AFDB:Q9VGD4	0.900	0.634	0.000	1726	0.555	0.389	Q9VGD4.pdb.gz	Q9VGD4_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=2
9	PDB:7vghB	0.868	0.886	1.338E-102	1183	0.522	0.533	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
10	AFDB:P70704	0.855	0.887	1.877E-101	1164	0.388	0.403	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
11	AFDB:Q9NTI2	0.857	0.871	1.582E-99	1188	0.384	0.391	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
12	AFDB:Q9XIE6	0.824	0.821	4.792E-99	1213	0.376	0.375	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
13	PDB:6rohA	0.817	0.885	1.577E-87	1112	0.368	0.400	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
14	PDB:7kycA	0.842	0.864	9.051E-85	1178	0.351	0.360	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:7kyaA	0.838	0.862	2.622E-78	1174	0.342	0.353	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:6k7lA	0.775	0.939	4.185E-75	992	0.366	0.446	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
17	PDB:7bspA	0.627	0.722	3.097E-68	1028	0.300	0.353	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.760	0.859	1.563E-63	1064	0.299	0.340	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.710	0.913	1.629E-60	929	0.237	0.309	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.559	0.800	3.644E-48	816	0.229	0.339	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K669	890	1496	0.363	0.293	A0A0B4K669_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
2	A0A0B4K756	766	1533	0.323	0.255	A0A0B4K756_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
3	A0A0B4LH22	895	1317	0.364	0.334	A0A0B4LH22_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
4	A0A0B4LH79	765	1448	0.323	0.270	A0A0B4LH79_DROME Phospholipid-transporting ATPase OS=Drosophila melanogaster OX=7227 GN=ATP8B PE=3 SV=1
5	A0A1D8PJN3	640	1479	0.315	0.258	A0A1D8PJN3_CANAL Phospholipid-transporting ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DNF1 PE=3 SV=1
6	A0A5K1VW70	2460	1190	0.978	0.993	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
7	A0A8I5ZKC1	744	985	0.325	0.399	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
8	A0A8I5ZXX6	879	1164	0.382	0.397	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
9	A0A8I6AVY6	879	1164	0.382	0.397	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
10	A0A8I6G2I8	745	978	0.324	0.401	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
11	A3FIN4	1417	1183	0.567	0.580	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
12	C7EXK4	872	1148	0.388	0.409	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
13	D4A3X6	870	1169	0.385	0.398	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
14	D4AA47	1256	1251	0.531	0.513	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
15	E9PEJ6	651	1191	0.331	0.336	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
16	F1LUT4	747	984	0.326	0.400	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
17	F4IE35	789	1185	0.385	0.393	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
18	F4K8T6	607	1139	0.305	0.324	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
19	H0Y547	583	935	0.292	0.378	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
20	O36028	608	1367	0.299	0.265	ATCZ_SCHPO Phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.16c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	3.7e-09	47.8	Cation transport ATPase (P-type)
2	PF13038 DUF3899	74	15.3	Domain of unknown function (DUF3899)
3	PF00122 E1-E2_ATPase	0.0016	29.5	E1-E2 ATPase
4	PF00702 Hydrolase	2.1e-05	36.5	haloacid dehalogenase-like hydrolase
5	PF08282 Hydrolase_3	1.9	19.8	haloacid dehalogenase-like hydrolase
6	PF16212 PhoLip_ATPase_C	8.3e-85	296.1	Phospholipid-translocating P-type ATPase C-terminal
7	PF16209 PhoLip_ATPase_N	1.2e-24	97.1	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008968535.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805856.1	0.842	Belongs to the CDC50/LEM3 family.
2	9597.XP_003821958.1	0.831	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
3	9597.XP_008955417.1	0.749	Transmembrane protein 30B
4	9597.XP_008973730.1	0.555	Tensin-3 isoform X1
5	9597.XP_003831487.2	0.548	ORMDL sphingolipid biosynthesis regulator 3
6	9597.XP_008950942.1	0.548	Probable phospholipid-transporting ATPase IIB isoform X1
7	9597.XP_003816040.1	0.540	MSS51 mitochondrial translational activator
8	9597.XP_008957830.1	0.540	Alpha kinase 3
9	9597.XP_008966458.1	0.533	Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IV subfamily
10	9597.XP_008952424.1	0.511	Belongs to the aldehyde dehydrogenase family.
11	9597.XP_003822794.1	0.504	Belongs to the CD36 family.
12	9597.XP_003818647.1	0.503	Belongs to the BI1 family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140333	0.997	glycerophospholipid flippase activity
GO:0008525	0.988	phosphatidylcholine transporter activity
GO:0015247	0.632	aminophospholipid flippase activity
GO:0140345	0.401	phosphatidylcholine flippase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051234	0.925	establishment of localization
GO:0006810	0.922	transport
GO:0006811	0.765	monoatomic ion transport
GO:0055085	0.756	transmembrane transport
GO:0034220	0.621	monoatomic ion transmembrane transport
GO:0065007	0.543	biological regulation
GO:0050896	0.429	response to stimulus
GO:0050794	0.317	regulation of cellular process
GO:0032502	0.305	developmental process
GO:0048856	0.304	anatomical structure development
GO:0042221	0.302	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0012505	0.996	endomembrane system
GO:0005794	0.766	Golgi apparatus
GO:0032991	0.754	protein-containing complex
GO:0005829	0.744	cytosol
GO:0031974	0.741	membrane-enclosed lumen
GO:0043232	0.683	intracellular non-membrane-bounded organelle
GO:0005634	0.682	nucleus
GO:0031981	0.628	nuclear lumen
GO:0031982	0.611	vesicle
GO:0031410	0.425	cytoplasmic vesicle
GO:0030659	0.355	cytoplasmic vesicle membrane
GO:0099503	0.343	secretory vesicle
GO:0030141	0.303	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]