StarFunc result for job id Q00005

User Input

>input (443 residues)
MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQREQESKNQ
VHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKLWKV
SERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHINSIS
VNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNTFVY
SSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIMTRD
YLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGSYNN
FFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILHTAW
HPSENIIAVAATNNLYIFQDKVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36877	0.971	0.971	1.564E-83	443	0.995	0.995	P36877.pdb.gz	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
2	AFDB:Q9Y2T4	0.960	0.951	1.135E-79	447	0.871	0.864	Q9Y2T4.pdb.gz	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
3	AFDB:P56932	0.957	0.936	9.427E-78	453	0.844	0.826	P56932.pdb.gz	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
4	AFDB:A2BG80	0.956	0.945	1.336E-76	448	0.828	0.819	A2BG80.pdb.gz	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
5	AFDB:P36872	0.931	0.828	9.209E-73	499	0.761	0.675	P36872.pdb.gz	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
6	AFDB:X1WDS4	0.950	0.944	3.558E-72	446	0.743	0.738	X1WDS4.pdb.gz	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
7	PDB:3dw8E	0.893	0.939	1.155E-66	421	0.819	0.862	3dw8E.pdb.gz	Structure of a protein phosphatase 2A holoenzyme: insights into B55-mediated Tau dephosphorylation.
8	AFDB:G5EDR3	0.910	0.816	3.323E-64	495	0.643	0.576	G5EDR3.pdb.gz	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
9	AFDB:C8VMY3	0.853	0.803	1.254E-58	472	0.573	0.538	C8VMY3.pdb.gz	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
10	AFDB:Q54Q99	0.852	0.783	1.321E-58	483	0.533	0.489	Q54Q99.pdb.gz	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1
11	AFDB:Q12702	0.834	0.798	3.150E-57	463	0.560	0.536	Q12702.pdb.gz	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
12	PDB:2h9lA	0.535	0.725	7.207E-15	321	0.183	0.252	2h9lA.pdb.gz
13	PDB:7mqaLO	0.536	0.300	2.008E-13	819	0.122	0.066	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5o9zL	0.541	0.523	4.860E-13	459	0.113	0.109	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
15	PDB:7vggA	0.520	0.742	6.993E-13	304	0.124	0.181	7vggA.pdb.gz
16	PDB:5nnzA	0.473	0.607	7.759E-13	335	0.147	0.194	5nnzA.pdb.gz
17	PDB:7r5jS0	0.542	0.724	8.173E-13	322	0.142	0.196	7r5jS0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:6bk8M	0.532	0.707	9.552E-13	326	0.117	0.160	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:5mzhB	0.512	0.543	1.006E-12	415	0.142	0.152	5mzhB.pdb.gz
20	PDB:5mqfF	0.539	0.756	1.305E-12	307	0.156	0.225	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2BG80	0.0	787	448	0.826	0.817	A2BG80_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=MDS026 PE=1 SV=3
2	G5EDR3	0.0	586	495	0.643	0.576	2AB1_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit sur-6 OS=Caenorhabditis elegans OX=6239 GN=sur-6 PE=1 SV=1
3	P36872	0.0	715	499	0.756	0.671	2ABA_DROME Protein phosphatase PP2A 55 kDa regulatory subunit OS=Drosophila melanogaster OX=7227 GN=tws PE=2 SV=1
4	P36876	0.0	810	447	0.851	0.843	2ABA_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2a PE=2 SV=1
5	P36877	0.0	923	443	0.995	0.995	2ABB_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2b PE=1 SV=2
6	P56932	0.0	800	453	0.842	0.823	2ABD_RAT Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Rattus norvegicus OX=10116 GN=Ppp2r2d PE=2 SV=1
7	P63151	0.0	810	447	0.849	0.841	2ABA_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R2A PE=1 SV=1
8	Q00005	0.0	926	443	1.000	1.000	2ABB_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Homo sapiens OX=9606 GN=PPP2R2B PE=1 SV=1
9	Q66LE6	0.0	800	453	0.840	0.821	2ABD_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Homo sapiens OX=9606 GN=PPP2R2D PE=1 SV=1
10	Q6IRD3	0.0	792	444	0.835	0.833	Q6IRD3_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Xenopus laevis OX=8355 GN=ppp2r2a.S PE=1 SV=1
11	Q6NY64	0.0	806	447	0.851	0.843	2ABD_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Danio rerio OX=7955 GN=ppp2r2d PE=2 SV=1
12	Q6P1F6	0.0	810	447	0.849	0.841	2ABA_MOUSE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform OS=Mus musculus OX=10090 GN=Ppp2r2a PE=1 SV=1
13	Q6PGU9	0.0	782	448	0.824	0.815	Q6PGU9_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2d PE=1 SV=1
14	Q7ZX64	0.0	794	447	0.835	0.828	2ABD_XENLA Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform OS=Xenopus laevis OX=8355 GN=ppp2r2d PE=1 SV=1
15	Q9Y2T4	0.0	835	447	0.871	0.864	2ABG_HUMAN Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R2C PE=1 SV=4
16	X1WDS4	0.0	717	446	0.743	0.738	X1WDS4_DANRE Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B OS=Danio rerio OX=7955 GN=ppp2r2aa PE=1 SV=1
17	C8VMY3	1.58e-174	499	472	0.573	0.538	C8VMY3_EMENI Protein phosphatase PP2A regulatory subunit B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01545 PE=3 SV=1
18	Q12702	4.48e-171	489	463	0.562	0.538	2ABA_SCHPO Protein phosphatase PP2A regulatory subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pab1 PE=1 SV=2
19	Q39247	2.30e-162	469	501	0.555	0.491	2ABB_ARATH Serine/threonine protein phosphatase 2A 55 kDa regulatory subunit B beta isoform OS=Arabidopsis thaliana OX=3702 GN=PP2AB2 PE=1 SV=1
20	Q54Q99	2.19e-159	461	483	0.544	0.499	PH2AB_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit phr2AB OS=Dictyostelium discoideum OX=44689 GN=phr2aB PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.59	21.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF00400 WD40	6e-07	41.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9402.XP_006923017.1

Rank	PPI partner	STRING score	Description
1	9402.XP_006905036.1	0.987	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like
2	9402.XP_006912906.1	0.983	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
3	9402.XP_006916394.1	0.983	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
4	9402.XP_006923189.1	0.983	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
5	9402.XP_006912607.1	0.893	Methylates the carboxyl group of the C-terminal leucine residue of protein phosphatase 2A catalytic subunits to form alpha- leucine ester residues
6	9402.XP_006919152.1	0.875	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform-like
7	9402.XP_006922335.1	0.831	Beta-arrestin-2
8	9402.XP_006917021.1	0.819	Protein phosphatase 2 regulatory subunit Balpha
9	9402.XP_006926687.1	0.819	Beta-arrestin-1
10	9402.XP_006916773.1	0.801	Serine/threonine-protein kinase 3-like
11	9402.XP_006913179.1	0.800	May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
12	9402.XP_006926673.1	0.776	Protein phosphatase methylesterase 1 isoform X1
13	9402.XP_006920504.1	0.764	Leucine carboxyl methyltransferase 2
14	9402.XP_006923831.1	0.748	Belongs to the TCP-1 chaperonin family.
15	9402.XP_006913776.1	0.737	lisH domain and HEAT repeat-containing protein KIAA1468 homolog isoform X1
16	9402.XP_006920141.1	0.737	Serine/threonine-protein phosphatase 4 regulatory subunit 1
17	9402.XP_006925618.1	0.737	Serine/threonine-protein phosphatase 4 regulatory subunit 4
18	9402.XP_006914148.1	0.707	Serine/threonine-protein phosphatase 4 catalytic subunit
19	9402.XP_006914322.1	0.704	RAC-gamma serine/threonine-protein kinase
20	9402.XP_006925670.1	0.704	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.907	enzyme regulator activity
GO:0019208	0.524	phosphatase regulator activity
GO:0019888	0.467	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.982	biological regulation
GO:0050794	0.957	regulation of cellular process
GO:0009987	0.950	cellular process
GO:0051179	0.791	localization
GO:0032501	0.677	multicellular organismal process
GO:0048518	0.659	positive regulation of biological process
GO:0032502	0.625	developmental process
GO:0048856	0.622	anatomical structure development
GO:0050896	0.476	response to stimulus
GO:0006810	0.474	transport
GO:0071840	0.465	cellular component organization or biogenesis
GO:0048285	0.441	organelle fission
GO:0031323	0.420	regulation of cellular metabolic process
GO:0080090	0.406	regulation of primary metabolic process
GO:0048522	0.394	positive regulation of cellular process
GO:0048869	0.393	cellular developmental process
GO:0071704	0.353	organic substance metabolic process
GO:0044237	0.350	cellular metabolic process
GO:0044238	0.344	primary metabolic process
GO:0007275	0.331	multicellular organism development
GO:0051171	0.327	regulation of nitrogen compound metabolic process
GO:0033036	0.325	macromolecule localization
GO:0048519	0.325	negative regulation of biological process
GO:0006807	0.309	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0032991	0.998	protein-containing complex
GO:0005829	0.984	cytosol
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:1902494	0.955	catalytic complex
GO:1903293	0.877	phosphatase complex
GO:0008287	0.856	protein serine/threonine phosphatase complex
GO:0005634	0.826	nucleus
GO:0070013	0.778	intracellular organelle lumen
GO:0031981	0.774	nuclear lumen
GO:0000159	0.700	protein phosphatase type 2A complex
GO:0005654	0.654	nucleoplasm
GO:0016020	0.457	membrane
GO:0012505	0.347	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]