StarFunc result for job id Q00056

User Input

>input (320 residues)
MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQL
PHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPP
AQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLA
DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYL
TRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGPPGKAQTQ
SPHLHPHPHPSTSTPVPSSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00056	0.999	0.999	4.731E-45	320	1.000	1.000	Q00056.pdb.gz	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
2	AFDB:O57374	0.303	0.393	1.423E-15	236	0.409	0.555	O57374.pdb.gz	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
3	AFDB:P31268	0.218	0.299	4.506E-11	230	0.244	0.339	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
4	AFDB:P09014	0.243	0.281	6.646E-11	275	0.278	0.324	P09014.pdb.gz	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
5	AFDB:P09013	0.249	0.286	1.543E-10	276	0.275	0.319	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
6	AFDB:P09630	0.243	0.326	2.427E-10	235	0.237	0.323	P09630.pdb.gz	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
7	AFDB:P02835	0.196	0.154	1.488E-9	410	0.263	0.205	P02835.pdb.gz	FTZ_DROME Segmentation protein fushi tarazu OS=Drosophila melanogaster OX=7227 GN=ftz PE=1 SV=2
8	AFDB:Q08820	0.283	0.299	3.455E-9	300	0.284	0.303	Q08820.pdb.gz	HXD1_XENLA Homeobox protein Hox-D1 OS=Xenopus laevis OX=8355 GN=hoxd1 PE=2 SV=3
9	AFDB:A5PLE8	0.217	0.266	7.515E-9	255	0.237	0.298	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
10	AFDB:Q99626	0.214	0.218	9.127E-9	313	0.256	0.262	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
11	PDB:2hi3A	0.168	0.634	1.075E-2	73	0.062	0.274	2hi3A.pdb.gz
12	PDB:4egcA	0.149	0.089	1.805E-2	539	0.044	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:5nr5A	0.126	0.320	7.241E-1	113	0.053	0.150	5nr5A.pdb.gz
14	PDB:7fbyA	0.129	0.243	8.243E-1	153	0.028	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:2cg4A	0.120	0.232	1.793	149	0.028	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:1yioA	0.103	0.158	1.913	198	0.031	0.051	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:5z56L	0.137	0.129	2.323	342	0.031	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:7ml4M	0.132	0.172	2.479	234	0.019	0.026	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
19	PDB:6v7wE	0.120	0.161	2.822	234	0.044	0.060	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
20	PDB:2vbwA	0.111	0.206	4.162	147	0.037	0.082	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00056	0.0	640	320	1.000	1.000	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
2	P06798	1.48e-109	322	285	0.675	0.758	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
3	H0YHX3	3.37e-99	290	140	0.434	0.993	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
4	O57374	7.25e-64	203	236	0.397	0.538	HXD4A_DANRE Homeobox protein Hox-D4a OS=Danio rerio OX=7955 GN=hoxd4a PE=2 SV=2
5	Q86TF7	6.54e-62	199	264	0.294	0.356	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1
6	Q08624	1.73e-61	198	264	0.291	0.352	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
7	P09017	2.03e-61	198	264	0.291	0.352	HXC4_HUMAN Homeobox protein Hox-C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=2
8	P09016	1.64e-57	188	255	0.272	0.341	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
9	P10628	2.13e-57	187	250	0.259	0.332	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
10	P07548	5.89e-47	168	586	0.241	0.131	DFD_DROME Homeotic protein deformed OS=Drosophila melanogaster OX=7227 GN=Dfd PE=1 SV=2
11	P09067	3.37e-43	151	269	0.206	0.245	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
12	P09013	3.83e-43	151	276	0.206	0.239	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
13	P20719	3.84e-43	151	270	0.206	0.244	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
14	P09079	3.87e-43	151	269	0.206	0.245	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
15	P09021	4.76e-43	151	270	0.206	0.244	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
16	P09014	7.95e-43	150	275	0.206	0.240	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
17	P52949	1.67e-40	143	233	0.194	0.266	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
18	P09077	2.30e-40	147	417	0.200	0.153	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
19	P32043	2.07e-38	137	222	0.241	0.347	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
20	Q00444	3.38e-38	137	222	0.212	0.306	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09974 DUF2209	4e+02	12.7	Uncharacterized protein conserved in archaea (DUF2209)
2	PF00046 Homeodomain	7.7e-19	78.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222726	0.766	Homeobox protein Hox-A5
2	9606.ENSP00000297283	0.721	Phosphoglycerate mutase 2
3	9606.ENSP00000216068	0.720	Dynein light chain 4, axonemal
4	9606.ENSP00000222718	0.680	Homeobox protein Hox-A2
5	9606.ENSP00000307305	0.614	DNA damage-inducible transcript 4 protein
6	9606.ENSP00000484411	0.578	Homeobox protein Hox-A3
7	9606.ENSP00000446916	0.575	Serine protease 58
8	9606.ENSP00000272369	0.565	Homeobox protein Meis1
9	9606.ENSP00000295108	0.550	Neurogenic differentiation factor 1
10	9606.ENSP00000362588	0.544	Pre-B-cell leukemia transcription factor 3
11	9606.ENSP00000308720	0.536	Trypsin-1
12	9606.ENSP00000395574	0.530	Elongin-A
13	9606.ENSP00000283921	0.504	Homeobox protein Hox-A10
14	9606.ENSP00000343619	0.502	Homeobox protein Hox-A9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.957	DNA-binding transcription factor activity
GO:0005515	0.951	protein binding
GO:0000981	0.849	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.668	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.549	cis-regulatory region sequence-specific DNA binding
GO:0001228	0.504	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.448	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.972	developmental process
GO:0048856	0.961	anatomical structure development
GO:0050789	0.912	regulation of biological process
GO:0050794	0.893	regulation of cellular process
GO:0019222	0.789	regulation of metabolic process
GO:0060255	0.778	regulation of macromolecule metabolic process
GO:0032501	0.776	multicellular organismal process
GO:0019219	0.776	regulation of nucleobase-containing compound metabolic process
GO:0009653	0.659	anatomical structure morphogenesis
GO:0009889	0.635	regulation of biosynthetic process
GO:0010468	0.635	regulation of gene expression
GO:0010556	0.633	regulation of macromolecule biosynthetic process
GO:0007275	0.629	multicellular organism development
GO:0031326	0.627	regulation of cellular biosynthetic process
GO:0051252	0.627	regulation of RNA metabolic process
GO:2001141	0.618	regulation of RNA biosynthetic process
GO:0006355	0.606	regulation of DNA-templated transcription
GO:0048731	0.567	system development
GO:0006357	0.505	regulation of transcription by RNA polymerase II
GO:0048518	0.462	positive regulation of biological process
GO:0048513	0.454	animal organ development
GO:0009987	0.420	cellular process
GO:0048522	0.418	positive regulation of cellular process
GO:0009893	0.360	positive regulation of metabolic process
GO:0051173	0.353	positive regulation of nitrogen compound metabolic process
GO:0010604	0.349	positive regulation of macromolecule metabolic process
GO:0031325	0.349	positive regulation of cellular metabolic process
GO:0009891	0.339	positive regulation of biosynthetic process
GO:0045935	0.336	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.327	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.614	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]