StarFunc result for job id Q00059

User Input

>input (246 residues)
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRF
SKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQ
LTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQE
KLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRK
YGAEEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KSU5	0.863	0.863	2.816E-34	246	1.000	1.000	E5KSU5.pdb.gz	E5KSU5_HUMAN Mitochondrial transcription factor A OS=Homo sapiens OX=9606 GN=TFAM PE=4 SV=1
2	AFDB:Q91ZW1	0.804	0.810	1.709E-23	244	0.622	0.627	Q91ZW1.pdb.gz	TFAM_RAT Transcription factor A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tfam PE=2 SV=1
3	AFDB:Q86BR8	0.493	0.442	6.260E-10	284	0.297	0.257	Q86BR8.pdb.gz	Q86BR8_DROME Mitochondrial transcription factor A, isoform B OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
4	AFDB:Q94234	0.484	0.566	7.786E-7	204	0.228	0.275	Q94234.pdb.gz	HMG5_CAEEL HMG box-containing protein 5 OS=Caenorhabditis elegans OX=6239 GN=hmg-5 PE=1 SV=1
5	AFDB:Q9T012	0.290	0.163	7.218E-6	446	0.224	0.123	Q9T012.pdb.gz	HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana OX=3702 GN=HMGB13 PE=2 SV=1
6	AFDB:Q9SUP7	0.304	0.170	8.068E-6	456	0.224	0.121	Q9SUP7.pdb.gz	HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana OX=3702 GN=HMGB6 PE=2 SV=1
7	AFDB:E9PKP7	0.353	0.147	9.019E-6	745	0.207	0.068	E9PKP7.pdb.gz	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
8	AFDB:Q57XJ9	0.298	0.271	3.069E-5	271	0.175	0.159	Q57XJ9.pdb.gz	Q57XJ9_TRYB2 High mobility group protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.25B21.90 PE=4 SV=1
9	AFDB:P25976	0.281	0.091	3.431E-5	765	0.207	0.067	P25976.pdb.gz	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
10	AFDB:P0CB47	0.325	0.216	7.075E-5	393	0.195	0.122	P0CB47.pdb.gz	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
11	PDB:1j5nA	0.273	0.644	1.753E-2	93	0.081	0.215	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:3ojaA	0.147	0.089	1.592	482	0.093	0.048	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
13	PDB:7qsmW	0.110	0.193	3.106	116	0.045	0.095	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
14	PDB:7qcdB	0.128	0.034	3.881	998	0.134	0.033	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
15	PDB:3gtyS	0.140	0.212	4.338	149	0.057	0.094	3gtyS.pdb.gz
16	PDB:1f6gA	0.148	0.211	5.420	160	0.073	0.113	1f6gA.pdb.gz
17	PDB:7ploI	0.182	0.102	5.420	451	0.037	0.020	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
18	PDB:7kahD	0.114	0.061	5.730	493	0.037	0.018	7kahD.pdb.gz
19	PDB:7pd3q	0.127	0.153	7.569	198	0.167	0.207	7pd3q.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
20	PDB:6iczL	0.146	0.082	8.002	454	0.146	0.079	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5KSU5	0.0	506	246	1.000	1.000	E5KSU5_HUMAN Mitochondrial transcription factor A OS=Homo sapiens OX=9606 GN=TFAM PE=4 SV=1
2	Q00059	0.0	506	246	1.000	1.000	TFAM_HUMAN Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
3	H7BYN3	1.81e-130	369	219	0.732	0.822	H7BYN3_HUMAN Transcription factor A, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=TFAM PE=1 SV=1
4	Q91ZW1	1.13e-110	320	244	0.618	0.623	TFAM_RAT Transcription factor A, mitochondrial OS=Rattus norvegicus OX=10116 GN=Tfam PE=2 SV=1
5	P40630	1.59e-109	317	243	0.610	0.617	TFAM_MOUSE Transcription factor A, mitochondrial OS=Mus musculus OX=10090 GN=Tfam PE=1 SV=2
6	Q9VDL2	7.04e-28	108	257	0.268	0.257	Q9VDL2_DROME LD40493p OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
7	Q86BR8	2.11e-27	108	284	0.268	0.232	Q86BR8_DROME Mitochondrial transcription factor A, isoform B OS=Drosophila melanogaster OX=7227 GN=TFAM PE=1 SV=1
8	Q94234	9.58e-13	67.0	204	0.228	0.275	HMG5_CAEEL HMG box-containing protein 5 OS=Caenorhabditis elegans OX=6239 GN=hmg-5 PE=1 SV=1
9	P0CB47	4.94e-10	61.2	393	0.183	0.115	UBFL1_HUMAN Upstream-binding factor 1-like protein 1 OS=Homo sapiens OX=9606 GN=UBTFL1 PE=1 SV=1
10	Q9T012	1.23e-09	60.1	446	0.215	0.119	HMG13_ARATH High mobility group B protein 13 OS=Arabidopsis thaliana OX=3702 GN=HMGB13 PE=2 SV=1
11	Q9SUP7	7.30e-09	57.8	456	0.232	0.125	HMGB6_ARATH High mobility group B protein 6 OS=Arabidopsis thaliana OX=3702 GN=HMGB6 PE=2 SV=1
12	Q57XJ9	7.67e-07	51.2	271	0.183	0.166	Q57XJ9_TRYB2 High mobility group protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.25B21.90 PE=4 SV=1
13	P25977	1.62e-06	50.8	764	0.183	0.059	UBF1_RAT Nucleolar transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Ubtf PE=1 SV=1
14	P17480	1.81e-06	50.8	764	0.183	0.059	UBF1_HUMAN Nucleolar transcription factor 1 OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
15	E9PKP7	2.39e-06	50.4	745	0.236	0.078	E9PKP7_HUMAN Upstream binding transcription factor OS=Homo sapiens OX=9606 GN=UBTF PE=1 SV=1
16	P25976	3.41e-06	50.1	765	0.183	0.059	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
17	P33417	4.70e-05	46.2	597	0.098	0.040	IXR1_YEAST Intrastrand cross-link recognition protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IXR1 PE=1 SV=2
18	Q9LG02	5.37e-05	45.8	337	0.098	0.071	HMG11_ARATH Putative high mobility group B protein 11 OS=Arabidopsis thaliana OX=3702 GN=HMGB11 PE=1 SV=2
19	O49596	6.15e-05	44.3	144	0.118	0.201	HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana OX=3702 GN=HMGB2 PE=1 SV=1
20	Q66JW3	7.79e-05	45.8	526	0.118	0.055	TOX_MOUSE Thymocyte selection-associated high mobility group box protein TOX OS=Mus musculus OX=10090 GN=Tox PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06244 Ccdc124	1.4	20.6	Coiled-coil domain-containing protein 124 /Oxs1
2	PF19466 DUF6003	2.4e+02	12.9	Family of unknown function (DUF6003)
3	PF00505 HMG_box	1.4e-27	107.2	HMG (high mobility group) box
4	PF09011 HMG_box_2	1e-17	75.8	HMG-box domain
5	PF14887 HMG_box_5	7.5	17.9	HMG (high mobility group) box 5
6	PF13454 NAD_binding_9	1.5e+02	13.8	FAD-NAD(P)-binding
7	PF06382 Protamine_like	2.7e+02	13.2	Protamine and protamine like
8	PF04690 YABBY	6.8	18.8	YABBY protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000420588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000465759	0.999	DNA-directed RNA polymerase, mitochondrial
2	9606.ENSP00000355471	0.998	Dimethyladenosine transferase 2, mitochondrial
3	9606.ENSP00000264867	0.994	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000269305	0.989	Cellular tumor antigen p53
5	9606.ENSP00000376924	0.988	Nuclear respiratory factor 1
6	9606.ENSP00000278070	0.979	Peroxisome proliferator-activated receptor gamma coactivator-related protein 1
7	9606.ENSP00000346886	0.974	GA-binding protein alpha chain
8	9606.ENSP00000220429	0.971	GA-binding protein subunit beta-1
9	9606.ENSP00000356134	0.956	Dimethyladenosine transferase 1, mitochondrial
10	9606.ENSP00000419665	0.945	Single-stranded DNA-binding protein, mitochondrial
11	9606.ENSP00000268124	0.926	DNA polymerase subunit gamma-1
12	9606.ENSP00000309595	0.877	Twinkle protein, mitochondrial
13	9606.ENSP00000355865	0.868	E3 ubiquitin-protein ligase parkin
14	9606.ENSP00000479488	0.835	Prohibitin
15	9606.ENSP00000449089	0.834	Dynamin-1-like protein
16	9606.ENSP00000212015	0.827	NAD-dependent protein deacetylase sirtuin-1
17	9606.ENSP00000354499	0.826	Cytochrome c oxidase subunit 1
18	9606.ENSP00000457513	0.818	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
19	9606.ENSP00000235329	0.804	Mitofusin-2
20	9606.ENSP00000353826	0.798	Lon protease homolog, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.997	transcription cis-regulatory region binding
GO:0003682	0.712	chromatin binding
GO:0008134	0.700	transcription factor binding
GO:0001223	0.628	transcription coactivator binding
GO:0031072	0.623	heat shock protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000959	0.997	mitochondrial RNA metabolic process
GO:0140053	0.995	mitochondrial gene expression
GO:0009059	0.995	macromolecule biosynthetic process
GO:0034654	0.995	nucleobase-containing compound biosynthetic process
GO:0006351	0.987	DNA-templated transcription
GO:0050789	0.978	regulation of biological process
GO:0050794	0.946	regulation of cellular process
GO:0019222	0.941	regulation of metabolic process
GO:0080090	0.918	regulation of primary metabolic process
GO:0051171	0.910	regulation of nitrogen compound metabolic process
GO:0031323	0.857	regulation of cellular metabolic process
GO:0060255	0.848	regulation of macromolecule metabolic process
GO:0019219	0.843	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.746	positive regulation of biological process
GO:0048522	0.717	positive regulation of cellular process
GO:0009893	0.695	positive regulation of metabolic process
GO:0031325	0.689	positive regulation of cellular metabolic process
GO:0051173	0.688	positive regulation of nitrogen compound metabolic process
GO:0010604	0.688	positive regulation of macromolecule metabolic process
GO:0009889	0.683	regulation of biosynthetic process
GO:0010468	0.679	regulation of gene expression
GO:0031326	0.638	regulation of cellular biosynthetic process
GO:0071840	0.574	cellular component organization or biogenesis
GO:0051252	0.570	regulation of RNA metabolic process
GO:0016043	0.540	cellular component organization
GO:0010556	0.538	regulation of macromolecule biosynthetic process
GO:0031328	0.501	positive regulation of cellular biosynthetic process
GO:0010557	0.500	positive regulation of macromolecule biosynthetic process
GO:0051254	0.489	positive regulation of RNA metabolic process
GO:0006996	0.428	organelle organization
GO:0006355	0.427	regulation of DNA-templated transcription
GO:1902680	0.389	positive regulation of RNA biosynthetic process
GO:0045893	0.382	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0032991	0.990	protein-containing complex
GO:0005634	0.981	nucleus
GO:0005829	0.972	cytosol
GO:0005759	0.852	mitochondrial matrix
GO:0031981	0.704	nuclear lumen
GO:0016020	0.412	membrane
GO:0009295	0.406	nucleoid
GO:0042645	0.364	mitochondrial nucleoid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]