StarFunc result for job id Q00169

User Input

>input (270 residues)
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHK
IYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLG
TQENVHKLEPEAWKHVEAVYIDIADRSQVLSKDYKAEEDPAKFKSIKTGRGPLGPNWKQE
LVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTM
DDIRRMEEETKRQLDEMRQKDPVKGMTADD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P16446	0.999	0.995	4.192E-56	271	0.993	0.989	P16446.pdb.gz	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
2	PDB:1uw5A	0.983	0.986	4.894E-50	269	0.993	0.996	1uw5A.pdb.gz	Structure-Function Analysis of Human [Corrected] Phosphatidylinositol Transfer Protein Alpha Bound to Phosphatidylinositol.
3	AFDB:P48739	0.993	0.989	3.366E-49	271	0.774	0.771	P48739.pdb.gz	PIPNB_HUMAN Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2
4	AFDB:F1QRW4	0.991	0.984	1.778E-48	272	0.759	0.754	F1QRW4.pdb.gz	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1
5	AFDB:Q803U3	0.985	0.981	3.724E-47	271	0.781	0.779	Q803U3.pdb.gz	Q803U3_DANRE Phosphatidylinositol transfer protein alpha isoform OS=Danio rerio OX=7955 GN=pitpna PE=1 SV=1
6	AFDB:Q802Z3	0.985	0.985	4.177E-47	270	0.763	0.763	Q802Z3.pdb.gz	Q802Z3_DANRE Phosphatidylinositol transfer protein, beta,-like OS=Danio rerio OX=7955 GN=zgc:55645 PE=1 SV=1
7	PDB:2a1lA	0.978	0.982	6.675E-45	269	0.763	0.766	2a1lA.pdb.gz
8	AFDB:A0A0B4KGG5	0.939	0.929	1.548E-36	273	0.600	0.593	A0A0B4KGG5.pdb.gz	A0A0B4KGG5_DROME Vibrator, isoform B OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
9	AFDB:Q9NCL8	0.913	0.934	1.197E-32	264	0.470	0.481	Q9NCL8.pdb.gz	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
10	AFDB:A0A024R5I7	0.893	0.199	7.047E-31	1244	0.456	0.099	A0A024R5I7.pdb.gz
11	AFDB:G5EED9	0.900	0.240	2.097E-30	1034	0.389	0.102	G5EED9.pdb.gz	G5EED9_CAEEL DDHD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pitp-1 PE=1 SV=1
12	AFDB:Q9NCL7	0.895	0.933	4.175E-30	259	0.441	0.459	Q9NCL7.pdb.gz	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
13	PDB:2qimA	0.353	0.534	1.066E-3	157	0.104	0.178	2qimA.pdb.gz	Lupinus luteus pathogenesis-related protein as a reservoir for cytokinin.
14	PDB:3kdhA	0.329	0.427	4.742E-3	189	0.070	0.101	3kdhA.pdb.gz
15	PDB:5jqmC	0.383	0.426	6.691E-3	236	0.119	0.136	5jqmC.pdb.gz
16	PDB:1ifvA	0.339	0.528	1.411E-2	155	0.089	0.155	1ifvA.pdb.gz
17	PDB:4c9iF	0.309	0.449	1.676E-2	162	0.074	0.123	4c9iF.pdb.gz	The Strawberry Pathogenesis-Related 10 (Pr-10) Fra a Proteins Control Flavonoid Biosynthesis by Binding to Metabolic Intermediates.
18	PDB:4ryvA	0.342	0.529	2.233E-2	155	0.100	0.174	4ryvA.pdb.gz	Crystallographic and CD probing of ligand-induced conformational changes in a plant PR-10 protein.
19	PDB:4qdcA	0.374	0.290	3.152E-2	369	0.100	0.073	4qdcA.pdb.gz	Substrate specificities and conformational flexibility of 3-ketosteroid 9 alpha-hydroxylases.
20	PDB:2flhB	0.298	0.471	3.535E-2	153	0.059	0.105	2flhB.pdb.gz	Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16446	0.0	558	271	0.993	0.989	PIPNA_RAT Phosphatidylinositol transfer protein alpha isoform OS=Rattus norvegicus OX=10116 GN=Pitpna PE=1 SV=2
2	P53810	0.0	557	271	0.989	0.985	PIPNA_MOUSE Phosphatidylinositol transfer protein alpha isoform OS=Mus musculus OX=10090 GN=Pitpna PE=1 SV=2
3	Q00169	0.0	564	270	1.000	1.000	PIPNA_HUMAN Phosphatidylinositol transfer protein alpha isoform OS=Homo sapiens OX=9606 GN=PITPNA PE=1 SV=2
4	Q2HJ54	0.0	554	270	0.978	0.978	PIPNA_BOVIN Phosphatidylinositol transfer protein alpha isoform OS=Bos taurus OX=9913 GN=PITPNA PE=1 SV=3
5	Q9TR36	9.29e-167	464	271	0.781	0.779	PIPNB_BOVIN Phosphatidylinositol transfer protein beta isoform OS=Bos taurus OX=9913 GN=PITPNB PE=1 SV=3
6	P48739	2.00e-166	463	271	0.778	0.775	PIPNB_HUMAN Phosphatidylinositol transfer protein beta isoform OS=Homo sapiens OX=9606 GN=PITPNB PE=1 SV=2
7	Q803U3	3.07e-165	460	271	0.789	0.786	Q803U3_DANRE Phosphatidylinositol transfer protein alpha isoform OS=Danio rerio OX=7955 GN=pitpna PE=1 SV=1
8	P53812	5.25e-165	459	271	0.774	0.771	PIPNB_RAT Phosphatidylinositol transfer protein beta isoform OS=Rattus norvegicus OX=10116 GN=Pitpnb PE=1 SV=2
9	P53811	7.96e-165	459	271	0.774	0.771	PIPNB_MOUSE Phosphatidylinositol transfer protein beta isoform OS=Mus musculus OX=10090 GN=Pitpnb PE=1 SV=2
10	Q802Z3	8.25e-158	441	270	0.763	0.763	Q802Z3_DANRE Phosphatidylinositol transfer protein, beta,-like OS=Danio rerio OX=7955 GN=zgc:55645 PE=1 SV=1
11	E7EZR3	8.25e-155	434	271	0.774	0.771	E7EZR3_DANRE Phosphatidylinositol transfer protein beta isoform isoform 2 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=3
12	F1QRW4	2.26e-152	427	272	0.759	0.754	F1QRW4_DANRE Phosphatidylinositol transfer protein beta isoform isoform 1 OS=Danio rerio OX=7955 GN=zgc:56092 PE=1 SV=1
13	Q9VDY8	7.27e-111	322	272	0.607	0.603	Q9VDY8_DROME MIP08680p OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
14	Q8T3L2	1.25e-109	319	272	0.607	0.603	Q8T3L2_DROME SD01527p OS=Drosophila melanogaster OX=7227 GN=vib PE=2 SV=1
15	A0A0B4KGG5	5.83e-109	318	273	0.607	0.601	A0A0B4KGG5_DROME Vibrator, isoform B OS=Drosophila melanogaster OX=7227 GN=vib PE=1 SV=1
16	Q9NCL8	3.05e-84	254	264	0.481	0.492	PITP1_DICDI Phosphatidylinositol transfer protein 1 OS=Dictyostelium discoideum OX=44689 GN=pitA PE=1 SV=1
17	Q9NCL7	1.35e-77	237	259	0.444	0.463	PITP2_DICDI Phosphatidylinositol transfer protein 2 OS=Dictyostelium discoideum OX=44689 GN=pitB PE=2 SV=1
18	Q5U2N3	5.20e-75	249	1242	0.459	0.100	PITM1_RAT Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1
19	O00562	4.16e-74	247	1244	0.459	0.100	PITM1_HUMAN Membrane-associated phosphatidylinositol transfer protein 1 OS=Homo sapiens OX=9606 GN=PITPNM1 PE=1 SV=4
20	Q6ZPQ6	4.60e-71	239	1335	0.444	0.090	PITM2_MOUSE Membrane-associated phosphatidylinositol transfer protein 2 OS=Mus musculus OX=10090 GN=Pitpnm2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18077 DUF5595	3.5e+02	12.7	Domain of unknown function (DUF5595)
2	PF02121 IP_trans	3.4e-116	398.7	Phosphatidylinositol transfer protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000173229	0.943	Netrin-1
2	9606.ENSP00000389140	0.940	Netrin receptor DCC
3	9606.ENSP00000244007	0.934	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
4	9606.ENSP00000376134	0.902	Signal transducer and activator of transcription 4
5	9606.ENSP00000264335	0.778	14-3-3 protein epsilon
6	9606.ENSP00000263071	0.773	Scavenger receptor class F member 1
7	9606.ENSP00000373713	0.753	Phosphatidylinositide phosphatase SAC1
8	9606.ENSP00000352834	0.745	Unconventional myosin-Ic
9	9606.ENSP00000288235	0.744	Unconventional myosin-Ie
10	9606.ENSP00000320236	0.744	Mitochondrial import inner membrane translocase subunit Tim22
11	9606.ENSP00000300574	0.736	Adapter molecule crk
12	9606.ENSP00000380378	0.730	Platelet-activating factor acetylhydrolase IB subunit alpha
13	9606.ENSP00000329548	0.720	Tumor suppressor candidate 5
14	9606.ENSP00000375248	0.720	Class A basic helix-loop-helix protein 9
15	9606.ENSP00000314080	0.639	Hypermethylated in cancer 1 protein
16	9606.ENSP00000378409	0.626	V-type immunoglobulin domain-containing suppressor of T-cell activation
17	9606.ENSP00000271732	0.593	Golgi phosphoprotein 3-like
18	9606.ENSP00000362656	0.591	Golgin subfamily A member 1
19	9606.ENSP00000254722	0.573	Pigment epithelium-derived factor
20	9606.ENSP00000260970	0.571	Peptidyl-prolyl cis-trans isomerase G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008525	0.999	phosphatidylcholine transporter activity
GO:0008526	0.999	phosphatidylinositol transfer activity
GO:0005488	0.998	binding
GO:0043167	0.989	ion binding
GO:0035091	0.987	phosphatidylinositol binding
GO:0043169	0.974	cation binding
GO:0031210	0.961	phosphatidylcholine binding
GO:0005515	0.922	protein binding
GO:0120019	0.778	phosphatidylcholine transfer activity
GO:0043168	0.743	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0015748	0.948	organophosphate ester transport
GO:0010876	0.939	lipid localization
GO:0071840	0.938	cellular component organization or biogenesis
GO:0016043	0.930	cellular component organization
GO:0006869	0.921	lipid transport
GO:0015914	0.910	phospholipid transport
GO:0032501	0.787	multicellular organismal process
GO:0032502	0.692	developmental process
GO:0048856	0.626	anatomical structure development
GO:0007275	0.527	multicellular organism development
GO:0030154	0.435	cell differentiation
GO:0022008	0.429	neurogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005829	0.984	cytosol
GO:0005634	0.966	nucleus
GO:0005576	0.958	extracellular region
GO:0031982	0.923	vesicle
GO:0016020	0.860	membrane
GO:0005615	0.858	extracellular space
GO:0070062	0.831	extracellular exosome
GO:0005794	0.678	Golgi apparatus
GO:0031984	0.641	organelle subcompartment
GO:0031090	0.544	organelle membrane
GO:0070013	0.516	intracellular organelle lumen
GO:0031981	0.357	nuclear lumen
GO:0098588	0.340	bounding membrane of organelle
GO:0043228	0.300	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]