StarFunc result for job id Q00325

User Input

>input (362 residues)
MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEQYSCDYG
SGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLA
KGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIAL
APMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFER
TVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSAS
LVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGL
TQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RBH9	0.929	0.929	1.871E-44	362	1.000	1.000	A0A024RBH9.pdb.gz	A0A024RBH9_HUMAN Solute carrier family 25 member 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A3 PE=2 SV=1
2	AFDB:Q8VEM8	0.942	0.955	3.127E-42	357	0.881	0.894	Q8VEM8.pdb.gz	S25A3_MOUSE Solute carrier family 25 member 3 OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1
3	AFDB:Q0E8E8	0.840	0.854	3.541E-33	356	0.671	0.683	Q0E8E8.pdb.gz	Q0E8E8_DROME MIP08013p1 OS=Drosophila melanogaster OX=7227 GN=Mpcp2 PE=1 SV=1
4	AFDB:F8VVM2	0.700	0.778	1.273E-32	324	0.862	0.963	F8VVM2.pdb.gz	F8VVM2_HUMAN Solute carrier family 25 member 3 OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=1
5	AFDB:O80414	0.803	0.790	1.051E-26	368	0.494	0.486	O80414.pdb.gz	O80414_ORYSJ Mitochondrial phosphate transporter OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0767500 PE=1 SV=1
6	AFDB:Q9FMU6	0.795	0.768	1.189E-26	375	0.492	0.475	Q9FMU6.pdb.gz	MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT3 PE=1 SV=1
7	AFDB:O80412	0.802	0.775	3.073E-26	375	0.486	0.469	O80412.pdb.gz	O80412_SOYBN Mitochondrial phosphate transporter OS=Glycine max OX=3847 GN=548006 PE=2 SV=1
8	AFDB:Q9M2Z8	0.800	0.798	7.943E-26	363	0.464	0.463	Q9M2Z8.pdb.gz	MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT2 PE=2 SV=1
9	AFDB:Q9P7V8	0.779	0.904	1.632E-23	311	0.436	0.508	Q9P7V8.pdb.gz	MPCP_SCHPO Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.13c PE=3 SV=1
10	AFDB:Q38DX9	0.760	0.866	5.684E-22	317	0.395	0.451	Q38DX9.pdb.gz	Q38DX9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1750 PE=3 SV=1
11	PDB:6gciA	0.498	0.598	2.917E-7	292	0.171	0.212	6gciA.pdb.gz	The Molecular Mechanism of Transport by the Mitochondrial ADP/ATP Carrier.
12	PDB:4c9qB	0.485	0.576	3.653E-5	290	0.152	0.190	4c9qB.pdb.gz	Structures of Yeast Mitochondrial Adp/ATP Carriers Support a Domain-Based Alternating-Access Transport Mechanism
13	PDB:2c3eA	0.469	0.555	1.209E-4	293	0.166	0.205	2c3eA.pdb.gz	Structural Basis for Lipid-Mediated Interactions between Mitochondrial Adp/ATP Carrier Monomers.
14	PDB:2lckA	0.433	0.500	6.912E-3	297	0.157	0.192	2lckA.pdb.gz
15	PDB:6s4mA	0.142	0.128	2.724E-1	426	0.141	0.120	6s4mA.pdb.gz
16	PDB:6wwzR	0.142	0.157	5.060E-1	310	0.119	0.139	6wwzR.pdb.gz
17	PDB:6oopA	0.151	0.144	7.040E-1	392	0.110	0.102	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
18	PDB:7lciR	0.135	0.129	8.654E-1	393	0.105	0.097	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
19	PDB:4pb1A	0.128	0.120	9.019E-1	404	0.124	0.111	4pb1A.pdb.gz	Structural basis of nucleoside and nucleoside drug selectivity by concentrative nucleoside transporters.
20	PDB:6iblA	0.119	0.115	9.399E-1	397	0.146	0.134	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RBE8	0.0	724	361	0.964	0.967	A0A024RBE8_HUMAN Solute carrier family 25 member 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A3 PE=2 SV=1
2	A0A024RBH9	0.0	749	362	1.000	1.000	A0A024RBH9_HUMAN Solute carrier family 25 member 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A3 PE=2 SV=1
3	F8VVM2	0.0	585	324	0.862	0.963	F8VVM2_HUMAN Solute carrier family 25 member 3 OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=1
4	P16036	0.0	592	356	0.876	0.890	S25A3_RAT Solute carrier family 25 member 3 OS=Rattus norvegicus OX=10116 GN=Slc25a3 PE=1 SV=1
5	Q00325	0.0	749	362	1.000	1.000	S25A3_HUMAN Solute carrier family 25 member 3 OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=2
6	Q8VEM8	0.0	622	357	0.881	0.894	S25A3_MOUSE Solute carrier family 25 member 3 OS=Mus musculus OX=10090 GN=Slc25a3 PE=1 SV=1
7	Q0E8E8	6.08e-161	456	356	0.677	0.688	Q0E8E8_DROME MIP08013p1 OS=Drosophila melanogaster OX=7227 GN=Mpcp2 PE=1 SV=1
8	Q9XZE4	2.75e-160	455	356	0.674	0.685	Q9XZE4_DROME Phosphate transporter OS=Drosophila melanogaster OX=7227 GN=Mpcp2 PE=2 SV=1
9	Q9FMU6	8.05e-120	353	375	0.472	0.456	MPCP3_ARATH Mitochondrial phosphate carrier protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT3 PE=1 SV=1
10	O80413	6.12e-118	348	366	0.472	0.467	O80413_MAIZE Mitochondrial phosphate transporter OS=Zea mays OX=4577 GN=103627788 PE=1 SV=1
11	Q9M2Z8	3.23e-117	345	363	0.445	0.444	MPCP2_ARATH Mitochondrial phosphate carrier protein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT2 PE=2 SV=1
12	O80414	5.71e-117	345	368	0.464	0.457	O80414_ORYSJ Mitochondrial phosphate transporter OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0767500 PE=1 SV=1
13	O80412	6.66e-115	340	375	0.461	0.445	O80412_SOYBN Mitochondrial phosphate transporter OS=Glycine max OX=3847 GN=548006 PE=2 SV=1
14	F8VWR4	2.66e-112	325	154	0.425	1.000	F8VWR4_HUMAN Solute carrier family 25 member 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=1
15	F8VWQ0	1.61e-102	300	156	0.390	0.904	F8VWQ0_HUMAN Solute carrier family 25 member 3 OS=Homo sapiens OX=9606 GN=SLC25A3 PE=1 SV=1
16	Q9P7V8	2.05e-99	298	311	0.425	0.495	MPCP_SCHPO Probable mitochondrial phosphate carrier protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1703.13c PE=3 SV=1
17	P40035	1.47e-93	283	300	0.395	0.477	PIC2_YEAST Mitochondrial phosphate carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIC2 PE=1 SV=1
18	Q38DX9	1.80e-92	281	317	0.398	0.454	Q38DX9_TRYB2 Mitochondrial carrier protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1750 PE=3 SV=1
19	Q7DNC3	6.39e-89	271	309	0.365	0.427	MPCP1_ARATH Mitochondrial phosphate carrier protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPT1 PE=2 SV=1
20	P23641	1.88e-72	229	311	0.359	0.418	MPCP_YEAST Mitochondrial phosphate carrier protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00153 Mito_carr	5.2e-45	162.6	Mitochondrial carrier protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262030	0.978	ATP synthase subunit beta, mitochondrial
2	9606.ENSP00000381736	0.957	ATP synthase subunit alpha, mitochondrial
3	9606.ENSP00000361635	0.943	Voltage-dependent anion-selective channel protein 2
4	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
5	9606.ENSP00000349142	0.936	ATP synthase subunit gamma, mitochondrial
6	9606.ENSP00000317159	0.923	Cytochrome c1, heme protein, mitochondrial
7	9606.ENSP00000358737	0.912	ATP synthase F(0) complex subunit B1, mitochondrial
8	9606.ENSP00000306397	0.907	Cytochrome b-c1 complex subunit Rieske, mitochondrial
9	9606.ENSP00000322439	0.895	Elongation factor Tu, mitochondrial
10	9606.ENSP00000268379	0.877	Cytochrome b-c1 complex subunit 2, mitochondrial
11	9606.ENSP00000377446	0.865	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
12	9606.ENSP00000434480	0.857	Alkaline ceramidase 3
13	9606.ENSP00000284727	0.852	ATP synthase F(0) complex subunit C3, mitochondrial
14	9606.ENSP00000307786	0.837	Cytochrome c
15	9606.ENSP00000363787	0.836	E3 ubiquitin-protein ligase RING1
16	9606.ENSP00000428845	0.818	Voltage-dependent anion-selective channel protein 3
17	9606.ENSP00000215375	0.811	ATP synthase subunit delta, mitochondrial
18	9606.ENSP00000203407	0.806	Cytochrome b-c1 complex subunit 1, mitochondrial
19	9606.ENSP00000258424	0.804	Cytochrome c oxidase subunit 5B, mitochondrial
20	9606.ENSP00000377060	0.775	Chromobox protein homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015078	0.999	proton transmembrane transporter activity
GO:0005515	0.998	protein binding
GO:0022853	0.998	active monoatomic ion transmembrane transporter activity
GO:0044877	0.996	protein-containing complex binding
GO:0015294	0.989	solute:monoatomic cation symporter activity
GO:0015295	0.833	solute:proton symporter activity
GO:0008514	0.811	organic anion transmembrane transporter activity
GO:0097159	0.412	organic cyclic compound binding
GO:1901363	0.400	heterocyclic compound binding
GO:1901702	0.353	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.885	cellular process
GO:0008152	0.703	metabolic process
GO:0006810	0.587	transport
GO:0044237	0.546	cellular metabolic process
GO:0071704	0.401	organic substance metabolic process
GO:0044238	0.338	primary metabolic process
GO:0065007	0.327	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0031090	0.926	organelle membrane
GO:0005740	0.445	mitochondrial envelope
GO:0032991	0.397	protein-containing complex
GO:0031966	0.384	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]