StarFunc result for job id Q00403

User Input

>input (316 residues)
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62915	0.913	0.913	4.156E-42	316	0.997	0.997	P62915.pdb.gz	TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1
2	AFDB:P29052	0.935	0.938	2.024E-39	315	0.791	0.794	P29052.pdb.gz	TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1
3	PDB:5iy7M	0.886	0.902	1.936E-37	310	0.981	1.000	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
4	PDB:5iy6M	0.739	0.887	1.115E-30	260	0.823	1.000	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
5	AFDB:Q9SS44	0.838	0.848	5.681E-22	312	0.437	0.442	Q9SS44.pdb.gz	TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana OX=3702 GN=TFIIB2 PE=2 SV=1
6	AFDB:P48512	0.842	0.852	1.055E-21	312	0.430	0.436	P48512.pdb.gz	TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana OX=3702 GN=TFIIB1 PE=1 SV=1
7	AFDB:O13749	0.850	0.793	2.866E-21	340	0.434	0.403	O13749.pdb.gz	TF2B_SCHPO Transcription initiation factor IIB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sua7 PE=3 SV=1
8	AFDB:Q9LIA6	0.824	0.778	1.000E-18	336	0.329	0.310	Q9LIA6.pdb.gz	PBRP2_ARATH Plant-specific TFIIB-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=PBRP2 PE=2 SV=1
9	AFDB:P29055	0.841	0.776	8.124E-18	345	0.345	0.316	P29055.pdb.gz	TF2B_YEAST Transcription initiation factor IIB OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUA7 PE=1 SV=1
10	PDB:4v1nM	0.750	0.788	5.669E-17	299	0.326	0.344	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
11	PDB:7zs9M	0.763	0.776	1.887E-14	310	0.310	0.316	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
12	AFDB:O23215	0.624	0.400	1.007E-13	503	0.256	0.161	O23215.pdb.gz	PBRP1_ARATH Plant-specific TFIIB-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=PBRP1 PE=2 SV=1
13	AFDB:P29056	0.685	0.375	8.179E-13	596	0.199	0.106	P29056.pdb.gz	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
14	AFDB:Q92994	0.713	0.348	1.593E-12	677	0.190	0.089	Q92994.pdb.gz	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
15	PDB:7ml4M	0.622	0.818	3.765E-10	234	0.234	0.316	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
16	PDB:6eu0Z	0.528	0.494	8.977E-8	339	0.149	0.139	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
17	PDB:6gzhB	0.248	0.305	7.163E-6	252	0.114	0.143	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
18	PDB:1g3nC	0.286	0.381	1.770E-5	233	0.101	0.137	1g3nC.pdb.gz
19	PDB:3g33B	0.259	0.345	1.856E-5	229	0.098	0.135	3g33B.pdb.gz
20	PDB:1zp2A	0.280	0.381	2.469E-5	227	0.111	0.154	1zp2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P29052	0.0	520	315	0.791	0.794	TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1
2	P62915	0.0	651	316	0.997	0.997	TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1
3	Q00403	0.0	652	316	1.000	1.000	TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
4	B1APE2	1.33e-171	476	231	0.731	1.000	B1APE2_HUMAN Transcription initiation factor IIB (Fragment) OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
5	B1APE1	5.45e-160	447	224	0.684	0.964	B1APE1_HUMAN Transcription initiation factor IIB (Fragment) OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
6	P48512	1.43e-81	251	312	0.434	0.439	TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana OX=3702 GN=TFIIB1 PE=1 SV=1
7	Q9SS44	4.41e-81	250	312	0.440	0.446	TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana OX=3702 GN=TFIIB2 PE=2 SV=1
8	O13749	6.90e-79	245	340	0.411	0.382	TF2B_SCHPO Transcription initiation factor IIB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sua7 PE=3 SV=1
9	P29055	7.72e-55	184	345	0.342	0.313	TF2B_YEAST Transcription initiation factor IIB OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUA7 PE=1 SV=1
10	Q9LIA6	3.09e-42	150	336	0.326	0.307	PBRP2_ARATH Plant-specific TFIIB-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=PBRP2 PE=2 SV=1
11	O23215	8.35e-29	117	503	0.212	0.133	PBRP1_ARATH Plant-specific TFIIB-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=PBRP1 PE=2 SV=1
12	Q9M2L0	4.40e-19	88.6	360	0.241	0.211	Q9M2L0_ARATH TFIIB4 OS=Arabidopsis thaliana OX=3702 GN=F28O9.220 PE=2 SV=1
13	Q6P9Z3	1.74e-15	79.3	693	0.206	0.094	Q6P9Z3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=zgc:63497 PE=2 SV=1
14	Q8CFK2	4.25e-14	75.1	676	0.222	0.104	TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus OX=10090 GN=Brf1 PE=1 SV=1
15	Q9NB72	9.89e-14	73.9	662	0.206	0.098	Q9NB72_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
16	Q9NG52	1.03e-13	73.9	662	0.206	0.098	Q9NG52_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
17	Q9VEL2	1.17e-13	73.6	662	0.206	0.098	Q9VEL2_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=1 SV=2
18	P29056	2.39e-13	72.8	596	0.203	0.107	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
19	Q92994	4.29e-13	72.0	677	0.212	0.099	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
20	Q54U85	1.04e-12	70.9	706	0.155	0.069	Q54U85_DICDI TATA box-binding protein-associated factor, RNA polymerase III, subunit 2 OS=Dictyostelium discoideum OX=44689 GN=brf1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02984 Cyclin_C	8.6	17.9	Cyclin, C-terminal domain
2	PF00134 Cyclin_N	1.7e-05	36.0	Cyclin, N-terminal domain
3	PF01857 RB_B	30	16.0	Retinoblastoma-associated protein B domain
4	PF04545 Sigma70_r4	50	14.8	Sigma-70, region 4
5	PF00382 TFIIB	3.3e-54	192.2	Transcription factor TFIIB repeat
6	PF08271 TF_Zn_Ribbon	8.8e-11	52.5	TFIIB zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 118797.XP_007468568.1

Rank	PPI partner	STRING score	Description
1	118797.XP_007445991.1	0.999	TATA-box-binding protein isoform X1
2	118797.XP_007460631.1	0.998	General transcription factor IIF subunit 1 isoform X1
3	118797.XP_007446048.1	0.997	TATA-box binding protein like 2
4	118797.XP_007464086.1	0.996	Transcription elongation factor A protein 1 isoform X1
5	118797.XP_007465866.1	0.996	TATA-box binding protein associated factor 3
6	118797.XP_007461366.1	0.995	ERCC excision repair 3, TFIIH core complex helicase subunit
7	118797.XP_007447686.1	0.994	General transcription factor IIE subunit 2-like isoform X1
8	118797.XP_007466523.1	0.994	General transcription factor IIF subunit 2
9	118797.XP_007450570.1	0.993	General transcription factor IIE subunit 1
10	118797.XP_007453051.1	0.993	TATA box-binding protein-like protein 1
11	118797.XP_007470529.1	0.992	General transcription factor IIA subunit 1
12	118797.XP_007457276.1	0.991	DNA-directed RNA polymerase II subunit RPB2
13	118797.XP_007458949.1	0.991	Transcription initiation factor IIA subunit 2
14	118797.XP_007460458.1	0.991	DNA-directed RNA polymerases I, II, and III subunit RPABC1
15	118797.XP_007449244.1	0.988	General transcription factor IIH subunit 4
16	118797.XP_007451420.1	0.987	General transcription factor IIH subunit 5
17	118797.XP_007461651.1	0.986	TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 250kDa
18	118797.XP_007468351.1	0.986	DNA-directed RNA polymerase II subunit RPB3
19	118797.XP_007468874.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 mRNAs, 17 Proteins
20	118797.XP_007448721.1	0.985	General transcription factor IIH subunit 3 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990841	0.998	promoter-specific chromatin binding
GO:0017025	0.998	TBP-class protein binding
GO:0003677	0.998	DNA binding
GO:1990837	0.962	sequence-specific double-stranded DNA binding
GO:0140223	0.946	general transcription initiation factor activity
GO:0019899	0.916	enzyme binding
GO:0016251	0.914	RNA polymerase II general transcription initiation factor activity
GO:0043175	0.897	RNA polymerase core enzyme binding
GO:0001046	0.878	core promoter sequence-specific DNA binding
GO:0001098	0.876	basal transcription machinery binding
GO:0001099	0.872	basal RNA polymerase II transcription machinery binding
GO:0000993	0.798	RNA polymerase II complex binding
GO:0061629	0.725	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003824	0.704	catalytic activity
GO:0016740	0.633	transferase activity
GO:0046966	0.443	nuclear thyroid hormone receptor binding
GO:0008270	0.441	zinc ion binding
GO:0000977	0.436	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000979	0.424	RNA polymerase II core promoter sequence-specific DNA binding
GO:0016746	0.416	acyltransferase activity
GO:0016407	0.409	acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0006351	0.984	DNA-templated transcription
GO:0065007	0.981	biological regulation
GO:0016043	0.966	cellular component organization
GO:0006366	0.949	transcription by RNA polymerase II
GO:0006352	0.904	DNA-templated transcription initiation
GO:0044085	0.869	cellular component biogenesis
GO:0022607	0.851	cellular component assembly
GO:0071824	0.827	protein-DNA complex subunit organization
GO:0051101	0.766	regulation of DNA binding
GO:0065004	0.741	protein-DNA complex assembly
GO:0050789	0.609	regulation of biological process
GO:0006367	0.545	transcription initiation at RNA polymerase II promoter
GO:1901564	0.440	organonitrogen compound metabolic process
GO:0050794	0.415	regulation of cellular process
GO:0019538	0.403	protein metabolic process
GO:0019222	0.391	regulation of metabolic process
GO:0060255	0.352	regulation of macromolecule metabolic process
GO:0080090	0.338	regulation of primary metabolic process
GO:0051171	0.338	regulation of nitrogen compound metabolic process
GO:0031323	0.338	regulation of cellular metabolic process
GO:0010468	0.332	regulation of gene expression
GO:0031326	0.301	regulation of cellular biosynthetic process
GO:0019219	0.301	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.992	nucleoplasm
GO:0043232	0.943	intracellular non-membrane-bounded organelle
GO:0032991	0.940	protein-containing complex
GO:0140513	0.756	nuclear protein-containing complex
GO:0005737	0.714	cytoplasm
GO:0061695	0.622	transferase complex, transferring phosphorus-containing groups
GO:0005667	0.612	transcription regulator complex
GO:0005694	0.594	chromosome
GO:0140535	0.549	intracellular protein-containing complex
GO:0016604	0.535	nuclear body
GO:0090575	0.532	RNA polymerase II transcription regulator complex
GO:0055029	0.447	nuclear DNA-directed RNA polymerase complex
GO:0016591	0.430	RNA polymerase II, holoenzyme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.633	Transferases.
EC:2.3.-.-	0.416	Acyltransferases.
EC:2.3.1.-	0.412	Transferring groups other than amino-acyl groups.

[back to server]