StarFunc result for job id Q00444

User Input

>input (222 residues)
MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHG
VDMAANPRAHPDRPACSAAAAPGHAPGRDEAAPLNPGMYSQKAARPALEERAKSSGEIKE
EQAQTGQPAGLSQPPAPPQIYPWMTKLHMSHETDGKRSRTSYTRYQTLELEKEFHFNRYL
TRRRRIEIANNLCLNERQIKIWFQNRRMKWKKDSKMKSKEAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32043	0.614	0.614	1.905E-29	222	0.995	0.995	P32043.pdb.gz	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
2	AFDB:P09021	0.379	0.313	5.797E-13	270	0.523	0.430	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
3	AFDB:P09013	0.388	0.316	1.056E-12	276	0.450	0.362	P09013.pdb.gz	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
4	AFDB:P31267	0.341	0.325	1.779E-10	233	0.374	0.356	P31267.pdb.gz	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
5	AFDB:P09024	0.336	0.343	8.228E-10	217	0.347	0.355	P09024.pdb.gz	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
6	AFDB:P09016	0.357	0.317	8.795E-10	255	0.383	0.333	P09016.pdb.gz	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
7	AFDB:A0A024RB51	0.370	0.319	3.806E-9	264	0.369	0.311	A0A024RB51.pdb.gz
8	AFDB:P34684	0.341	0.301	7.916E-9	253	0.306	0.269	P34684.pdb.gz	LIN39_CAEEL Homeobox protein lin-39 OS=Caenorhabditis elegans OX=6239 GN=lin-39 PE=1 SV=1
9	AFDB:A0A024RA33	0.345	0.180	1.180E-8	443	0.369	0.185	A0A024RA33.pdb.gz
10	AFDB:Q8AXR4	0.330	0.322	1.441E-8	228	0.302	0.294	Q8AXR4.pdb.gz	Q8AXR4_DANRE Caudal type homeobox 1a OS=Danio rerio OX=7955 GN=cdx2 PE=2 SV=2
11	PDB:4egcA	0.197	0.081	2.246E-2	539	0.059	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.232	0.624	6.518E-2	73	0.068	0.205	2hi3A.pdb.gz
13	PDB:7fbyA	0.165	0.227	1.142	153	0.032	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:3kloA	0.141	0.143	2.714	217	0.059	0.060	3kloA.pdb.gz	Vibrio cholerae VpsT Regulates Matrix Production and Motility by Directly Sensing Cyclic di-GMP.
15	PDB:5aj0BZ	0.181	0.407	2.901	86	0.036	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:1yioA	0.142	0.157	3.100	198	0.045	0.051	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
17	PDB:4zzlA	0.130	0.186	3.542	146	0.054	0.082	4zzlA.pdb.gz
18	PDB:5nr5A	0.175	0.319	3.542	113	0.036	0.071	5nr5A.pdb.gz
19	PDB:6dv9F	0.112	0.133	3.542	174	0.041	0.052	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:2cg4A	0.173	0.250	4.325	149	0.023	0.034	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00444	1.33e-168	464	222	1.000	1.000	HXC5_HUMAN Homeobox protein Hox-C5 OS=Homo sapiens OX=9606 GN=HOXC5 PE=1 SV=1
2	P32043	2.27e-167	461	222	0.995	0.995	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
3	P20719	8.78e-51	167	270	0.514	0.422	HXA5_HUMAN Homeobox protein Hox-A5 OS=Homo sapiens OX=9606 GN=HOXA5 PE=1 SV=2
4	P09013	3.12e-50	166	276	0.509	0.409	HXB5B_DANRE Homeobox protein Hox-B5b OS=Danio rerio OX=7955 GN=hoxb5b PE=2 SV=2
5	P09021	3.65e-50	166	270	0.509	0.419	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
6	P09067	8.90e-50	165	269	0.482	0.398	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
7	P09014	2.33e-49	164	275	0.486	0.393	HXB5A_DANRE Homeobox protein Hox-B5a OS=Danio rerio OX=7955 GN=hoxb5a PE=2 SV=2
8	P09079	1.05e-48	162	269	0.500	0.413	HXB5_MOUSE Homeobox protein Hox-B5 OS=Mus musculus OX=10090 GN=Hoxb5 PE=1 SV=3
9	P52949	7.11e-42	143	233	0.288	0.275	HXA5_RAT Homeobox protein Hox-A5 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hoxa5 PE=2 SV=1
10	P09077	3.17e-41	146	417	0.324	0.173	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
11	P10628	2.49e-38	135	250	0.306	0.272	HXD4_MOUSE Homeobox protein Hox-D4 OS=Mus musculus OX=10090 GN=Hoxd4 PE=1 SV=3
12	Q00056	2.69e-38	137	320	0.351	0.244	HXA4_HUMAN Homeobox protein Hox-A4 OS=Homo sapiens OX=9606 GN=HOXA4 PE=2 SV=3
13	P06798	8.32e-38	134	285	0.270	0.211	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
14	H0YHX3	9.17e-38	130	140	0.270	0.429	H0YHX3_HUMAN Homeobox A4 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA4 PE=1 SV=1
15	P09016	1.75e-36	130	255	0.293	0.255	HXD4_HUMAN Homeobox protein Hox-D4 OS=Homo sapiens OX=9606 GN=HOXD4 PE=1 SV=3
16	P31267	1.77e-36	129	233	0.257	0.245	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
17	P09629	2.09e-36	129	217	0.266	0.272	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
18	P09092	2.38e-36	129	232	0.257	0.246	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2
19	P09023	2.47e-36	129	224	0.261	0.259	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
20	P17509	2.75e-36	129	224	0.261	0.259	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3.3e-18	76.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309336

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000399808	0.909	Homeobox protein Hox-C4
2	9606.ENSP00000243108	0.886	Homeobox protein Hox-C6
3	9606.ENSP00000328928	0.846	Homeobox protein Hox-B4
4	9606.ENSP00000239151	0.845	Homeobox protein Hox-B5
5	9606.ENSP00000420009	0.843	Homeobox protein Hox-B6
6	9606.ENSP00000302548	0.841	Homeobox protein Hox-D4
7	9606.ENSP00000222726	0.837	Homeobox protein Hox-A5
8	9606.ENSP00000242159	0.835	Homeobox protein Hox-A7
9	9606.ENSP00000222728	0.831	Homeobox protein Hox-A6
10	9606.ENSP00000239165	0.829	Homeobox protein Hox-B7
11	9606.ENSP00000476742	0.812	Uncharacterized protein
12	9606.ENSP00000251203	0.611	Pre-B-cell leukemia transcription factor 4
13	9606.ENSP00000444198	0.536	Cbp/p300-interacting transactivator 2
14	9606.ENSP00000302836	0.530	Homeobox protein Hox-C9
15	9606.ENSP00000040584	0.529	Homeobox protein Hox-C8
16	9606.ENSP00000362103	0.525	POU domain, class 3, transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003700	0.999	DNA-binding transcription factor activity
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0000976	0.976	transcription cis-regulatory region binding
GO:0000981	0.948	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.914	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.474	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.424	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.325	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.996	anatomical structure development
GO:0019222	0.990	regulation of metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0009889	0.981	regulation of biosynthetic process
GO:0010468	0.979	regulation of gene expression
GO:0007275	0.975	multicellular organism development
GO:0080090	0.967	regulation of primary metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0006355	0.949	regulation of DNA-templated transcription
GO:0006357	0.865	regulation of transcription by RNA polymerase II
GO:0048731	0.826	system development
GO:0048518	0.736	positive regulation of biological process
GO:0048522	0.733	positive regulation of cellular process
GO:0010604	0.557	positive regulation of macromolecule metabolic process
GO:0045893	0.547	positive regulation of DNA-templated transcription
GO:0007389	0.511	pattern specification process
GO:0045944	0.483	positive regulation of transcription by RNA polymerase II
GO:0003002	0.480	regionalization
GO:0009790	0.474	embryo development
GO:0001501	0.469	skeletal system development
GO:0009952	0.468	anterior/posterior pattern specification
GO:0048513	0.462	animal organ development
GO:0009792	0.422	embryo development ending in birth or egg hatching
GO:0048519	0.317	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0030054	0.427	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]