StarFunc result for job id Q00534

User Input

>input (326 residues)
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1MA87	0.945	0.945	1.399E-58	326	0.936	0.936	F1MA87.pdb.gz	F1MA87_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2
2	PDB:1blxA	0.867	0.925	5.540E-52	305	0.936	1.000	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
3	AFDB:Q91727	0.903	0.922	5.426E-49	319	0.653	0.668	Q91727.pdb.gz	CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis OX=8355 GN=cdk4 PE=1 SV=1
4	AFDB:A0A024RBB6	0.811	0.870	4.705E-43	303	0.638	0.686	A0A024RBB6.pdb.gz
5	PDB:1bi7A	0.723	0.869	4.659E-40	269	0.816	0.989	1bi7A.pdb.gz
6	PDB:2w96B	0.784	0.953	5.742E-37	267	0.610	0.745	2w96B.pdb.gz
7	AFDB:E7F5L4	0.832	0.887	3.244E-36	305	0.469	0.502	E7F5L4.pdb.gz	E7F5L4_DANRE Cyclin-dependent kinase 21 OS=Danio rerio OX=7955 GN=cdk21 PE=3 SV=1
8	PDB:2w99B	0.846	0.945	1.400E-35	291	0.638	0.715	2w99B.pdb.gz
9	PDB:4tthB	0.703	0.888	2.581E-34	256	0.776	0.988	4tthB.pdb.gz	Discovery of AMG 925, a FLT3 and CDK4 dual kinase inhibitor with preferential affinity for the activated state of FLT3.
10	AFDB:Q7K306	0.821	0.844	7.832E-33	317	0.414	0.426	Q7K306.pdb.gz	Q7K306_DROME Cyclin-dependent kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
11	AFDB:P43063	0.826	0.848	1.091E-31	317	0.420	0.432	P43063.pdb.gz	CDK1_CANAL Cyclin-dependent kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC28 PE=1 SV=1
12	AFDB:P24033	0.824	0.887	4.427E-31	302	0.436	0.470	P24033.pdb.gz	CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis OX=8355 GN=cdk1-b PE=1 SV=2
13	AFDB:Q00526	0.810	0.863	4.952E-31	305	0.436	0.466	Q00526.pdb.gz	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
14	AFDB:P23437	0.814	0.891	6.931E-31	297	0.433	0.475	P23437.pdb.gz	CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis OX=8355 GN=cdk2 PE=1 SV=3
15	AFDB:P24100	0.819	0.905	1.085E-30	294	0.429	0.476	P24100.pdb.gz	CDKA1_ARATH Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana OX=3702 GN=CDKA-1 PE=1 SV=1
16	PDB:4ek6A	0.770	0.896	5.513E-29	279	0.417	0.487	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
17	PDB:4gcjA	0.795	0.850	5.486E-28	304	0.436	0.467	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
18	PDB:4yc3A	0.774	0.850	6.490E-28	295	0.414	0.458	4yc3A.pdb.gz
19	PDB:4eomC	0.694	0.813	1.489E-25	276	0.414	0.489	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:1unlA	0.706	0.784	5.714E-25	292	0.399	0.445	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A5X3	0.0	566	306	0.844	0.899	A0A8I6A5X3_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=1
2	F1MA87	0.0	650	326	0.966	0.966	F1MA87_RAT Cyclin-dependent kinase 6 OS=Rattus norvegicus OX=10116 GN=Cdk6 PE=1 SV=2
3	Q00534	0.0	674	326	1.000	1.000	CDK6_HUMAN Cyclin-dependent kinase 6 OS=Homo sapiens OX=9606 GN=CDK6 PE=1 SV=1
4	Q64261	0.0	652	326	0.963	0.963	CDK6_MOUSE Cyclin-dependent kinase 6 OS=Mus musculus OX=10090 GN=Cdk6 PE=1 SV=2
5	Q91727	1.47e-155	440	319	0.641	0.655	CDK4_XENLA Cyclin-dependent kinase 4 OS=Xenopus laevis OX=8355 GN=cdk4 PE=1 SV=1
6	P79432	4.72e-151	428	303	0.644	0.693	CDK4_PIG Cyclin-dependent kinase 4 OS=Sus scrofa OX=9823 GN=CDK4 PE=3 SV=1
7	P35426	2.72e-150	426	303	0.635	0.683	CDK4_RAT Cyclin-dependent kinase 4 OS=Rattus norvegicus OX=10116 GN=Cdk4 PE=1 SV=1
8	P30285	3.77e-150	426	303	0.635	0.683	CDK4_MOUSE Cyclin-dependent kinase 4 OS=Mus musculus OX=10090 GN=Cdk4 PE=1 SV=1
9	P11802	5.18e-150	425	303	0.647	0.696	CDK4_HUMAN Cyclin-dependent kinase 4 OS=Homo sapiens OX=9606 GN=CDK4 PE=1 SV=2
10	E7F5L4	6.82e-106	313	305	0.472	0.505	E7F5L4_DANRE Cyclin-dependent kinase 21 OS=Danio rerio OX=7955 GN=cdk21 PE=3 SV=1
11	Q7K306	3.45e-95	286	317	0.414	0.426	Q7K306_DROME Cyclin-dependent kinase 4, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
12	Q94877	1.14e-94	285	317	0.411	0.423	Q94877_DROME CDK4/6 kinase OS=Drosophila melanogaster OX=7227 GN=Cdk4 PE=2 SV=1
13	Q00526	2.34e-92	279	305	0.436	0.466	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
14	P34117	1.49e-91	276	292	0.439	0.490	CDK5_DICDI Cyclin-dependent kinase 5 homolog OS=Dictyostelium discoideum OX=44689 GN=cdk5 PE=2 SV=2
15	P24941	7.45e-91	275	298	0.445	0.487	CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2
16	O55076	1.40e-90	274	298	0.442	0.483	CDK2_CRIGR Cyclin-dependent kinase 2 OS=Cricetulus griseus OX=10029 GN=CDK2 PE=1 SV=1
17	Q63699	2.84e-90	273	298	0.442	0.483	CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus OX=10116 GN=Cdk2 PE=1 SV=1
18	P23437	5.33e-90	273	297	0.442	0.485	CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis OX=8355 GN=cdk2 PE=1 SV=3
19	P34112	2.47e-89	271	296	0.445	0.490	CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum OX=44689 GN=cdk1 PE=2 SV=1
20	P29618	4.31e-89	270	294	0.442	0.490	CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.04	24.6	ABC1 atypical kinase-like domain
2	PF01636 APH	0.0074	27.7	Phosphotransferase enzyme family
3	PF13095 FTA2	71	14.5	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	2.9	18.3	Haspin like kinase domain
5	PF06293 Kdo	0.21	22.5	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	48	14.7	Kinase-like
7	PF00069 Pkinase	4.1e-65	231.4	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	1e-31	121.8	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	68	14.5	RIO1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010387789.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351690.1	0.999	Cyclin-dependent kinase inhibitor 2A
2	61622.XP_010357447.1	0.999	Belongs to the cyclin family.
3	61622.XP_010367952.1	0.999	Cyclin D3
4	61622.XP_010372062.1	0.999	Cyclin-dependent kinase 4 inhibitor D
5	61622.XP_010380433.1	0.999	Belongs to the cyclin family.
6	61622.XP_010374887.1	0.998	Cyclin-dependent kinase 4 inhibitor C
7	61622.XP_010387996.1	0.997	Cyclin-dependent kinase inhibitor 1
8	61622.XP_010351689.1	0.995	Cyclin-dependent kinase 4 inhibitor B
9	61622.XP_010354087.1	0.995	Belongs to the cyclin family.
10	61622.XP_010369310.1	0.995	Cyclin dependent kinase inhibitor 1B
11	61622.XP_010358945.1	0.994	Belongs to the cyclin family.
12	61622.XP_010362160.1	0.994	RB transcriptional corepressor 1
13	61622.XP_010377235.1	0.994	This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand
14	61622.XP_010376127.1	0.989	Belongs to the protein kinase superfamily.
15	61622.XP_010373022.1	0.981	Cell division cycle 25A
16	61622.XP_010360864.1	0.980	Belongs to the cyclin family.
17	61622.XP_010387225.1	0.980	Belongs to the protein kinase superfamily.
18	61622.XP_010381400.1	0.961	Belongs to the cyclin family.
19	61622.XP_010353624.1	0.957	RB transcriptional corepressor like 1
20	61622.XP_010356527.1	0.951	RB transcriptional corepressor like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0030332	0.998	cyclin binding
GO:0097472	0.489	cyclin-dependent protein kinase activity
GO:0004693	0.455	cyclin-dependent protein serine/threonine kinase activity
GO:1901363	0.433	heterocyclic compound binding
GO:0097159	0.433	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.903	positive regulation of biological process
GO:0050896	0.887	response to stimulus
GO:0019222	0.887	regulation of metabolic process
GO:0060255	0.874	regulation of macromolecule metabolic process
GO:0032502	0.867	developmental process
GO:0051171	0.864	regulation of nitrogen compound metabolic process
GO:0031323	0.859	regulation of cellular metabolic process
GO:0080090	0.857	regulation of primary metabolic process
GO:0048522	0.830	positive regulation of cellular process
GO:0048856	0.794	anatomical structure development
GO:0008152	0.769	metabolic process
GO:0071704	0.760	organic substance metabolic process
GO:0048519	0.750	negative regulation of biological process
GO:0043170	0.747	macromolecule metabolic process
GO:0044238	0.745	primary metabolic process
GO:0006807	0.733	nitrogen compound metabolic process
GO:0048523	0.709	negative regulation of cellular process
GO:0044237	0.707	cellular metabolic process
GO:0010468	0.626	regulation of gene expression
GO:0009893	0.603	positive regulation of metabolic process
GO:0051716	0.570	cellular response to stimulus
GO:1901564	0.562	organonitrogen compound metabolic process
GO:0010604	0.513	positive regulation of macromolecule metabolic process
GO:0019219	0.513	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.474	regulation of biosynthetic process
GO:0009892	0.451	negative regulation of metabolic process
GO:0010556	0.451	regulation of macromolecule biosynthetic process
GO:0031326	0.450	regulation of cellular biosynthetic process
GO:0019538	0.447	protein metabolic process
GO:0007165	0.442	signal transduction
GO:0031325	0.422	positive regulation of cellular metabolic process
GO:0051252	0.413	regulation of RNA metabolic process
GO:0051726	0.404	regulation of cell cycle
GO:0031324	0.398	negative regulation of cellular metabolic process
GO:0006355	0.388	regulation of DNA-templated transcription
GO:0043412	0.381	macromolecule modification
GO:0010605	0.378	negative regulation of macromolecule metabolic process
GO:0051172	0.366	negative regulation of nitrogen compound metabolic process
GO:0048583	0.350	regulation of response to stimulus
GO:0051173	0.349	positive regulation of nitrogen compound metabolic process
GO:0051246	0.325	regulation of protein metabolic process
GO:0006950	0.316	response to stress
GO:0032501	0.303	multicellular organismal process
GO:0010646	0.301	regulation of cell communication
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0005634	0.996	nucleus
GO:0031981	0.977	nuclear lumen
GO:1990234	0.974	transferase complex
GO:0005654	0.972	nucleoplasm
GO:0005829	0.957	cytosol
GO:0061695	0.847	transferase complex, transferring phosphorus-containing groups
GO:1902911	0.828	protein kinase complex
GO:0043228	0.825	non-membrane-bounded organelle
GO:1902554	0.819	serine/threonine protein kinase complex
GO:0043232	0.813	intracellular non-membrane-bounded organelle
GO:0000307	0.765	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.22	0.455	cyclin-dependent kinase.

[back to server]