StarFunc result for job id Q00587

User Input

>input (391 residues)
MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGD
TSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAI
SLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGS
FPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTG
PAANPPATTANPPAPAANPSAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEV
KSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRA
PQAGSRTPVPSTVQANTFEFADAEEDDEVKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00587	0.999	0.999	3.303E-57	391	1.000	1.000	Q00587.pdb.gz	BORG5_HUMAN Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1
2	AFDB:Q91W92	0.330	0.318	1.305E-37	409	0.747	0.714	Q91W92.pdb.gz	BORG5_MOUSE Cdc42 effector protein 1 OS=Mus musculus OX=10090 GN=Cdc42ep1 PE=1 SV=1
3	AFDB:P03966	0.076	0.068	3.596E-2	462	0.171	0.145	P03966.pdb.gz	MYCN_MOUSE N-myc proto-oncogene protein OS=Mus musculus OX=10090 GN=Mycn PE=2 SV=2
4	AFDB:Q04429	0.068	0.063	5.001E-2	423	0.130	0.121	Q04429.pdb.gz	HLR1_YEAST Protein HLR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HLR1 PE=1 SV=1
5	AFDB:A0A1D8PMZ4	0.085	0.058	6.096E-2	685	0.107	0.061	A0A1D8PMZ4.pdb.gz	A0A1D8PMZ4_CANAL Hms1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMS1 PE=4 SV=1
6	AFDB:A0A494C0P1	0.099	0.060	9.673E-2	746	0.169	0.088	A0A494C0P1.pdb.gz	A0A494C0P1_HUMAN Glucocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C1 PE=1 SV=1
7	AFDB:P49686	0.079	0.073	9.673E-2	430	0.161	0.147	P49686.pdb.gz	NUP42_YEAST Nucleoporin NUP42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP42 PE=1 SV=1
8	AFDB:Q5T8P6	0.078	0.041	2.436E-1	1007	0.184	0.071	Q5T8P6.pdb.gz	RBM26_HUMAN RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3
9	AFDB:Q9SNQ6	0.072	0.041	2.780E-1	760	0.182	0.093	Q9SNQ6.pdb.gz	HD3B_ORYSJ Protein HEADING DATE 3B OS=Oryza sativa subsp. japonica OX=39947 GN=HD3B PE=2 SV=1
10	AFDB:B2MZC6	0.078	0.057	3.172E-1	606	0.156	0.101	B2MZC6.pdb.gz	B2MZC6_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zim-1 PE=4 SV=1
11	PDB:6b2eB	0.051	0.075	9.196	193	0.028	0.057	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00587	0.0	772	391	1.000	1.000	BORG5_HUMAN Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1 PE=1 SV=1
2	Q91W92	1.04e-159	456	409	0.731	0.699	BORG5_MOUSE Cdc42 effector protein 1 OS=Mus musculus OX=10090 GN=Cdc42ep1 PE=1 SV=1
3	B2R6D8	4.57e-17	84.0	356	0.205	0.225	B2R6D8_HUMAN CDC42 effector protein (Rho GTPase binding) 4, isoform CRA_a OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=2 SV=1
4	Q9H3Q1	4.57e-17	84.0	356	0.205	0.225	BORG4_HUMAN Cdc42 effector protein 4 OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
5	Q9JM96	5.10e-16	80.9	349	0.205	0.229	BORG4_MOUSE Cdc42 effector protein 4 OS=Mus musculus OX=10090 GN=Cdc42ep4 PE=1 SV=1
6	J3KRZ9	5.04e-15	73.2	127	0.136	0.417	J3KRZ9_HUMAN CDC42 effector protein 4 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP4 PE=1 SV=1
7	Q9Z0X0	1.61e-10	61.2	150	0.079	0.207	BORG3_MOUSE Cdc42 effector protein 5 OS=Mus musculus OX=10090 GN=Cdc42ep5 PE=1 SV=2
8	Q6NZY7	3.10e-10	60.5	148	0.066	0.176	BORG3_HUMAN Cdc42 effector protein 5 OS=Homo sapiens OX=9606 GN=CDC42EP5 PE=2 SV=1
9	Q8JZX9	4.03e-10	61.6	214	0.110	0.201	BORG1_MOUSE Cdc42 effector protein 2 OS=Mus musculus OX=10090 GN=Cdc42ep2 PE=1 SV=1
10	O14613	2.93e-09	58.9	210	0.110	0.205	BORG1_HUMAN Cdc42 effector protein 2 OS=Homo sapiens OX=9606 GN=CDC42EP2 PE=1 SV=1
11	C9JEZ4	1.05e-08	57.4	215	0.102	0.186	C9JEZ4_HUMAN CDC42 effector protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=8
12	Q9UKI2	1.25e-08	57.8	254	0.102	0.157	BORG2_HUMAN Cdc42 effector protein 3 OS=Homo sapiens OX=9606 GN=CDC42EP3 PE=1 SV=1
13	Q9CQC5	5.53e-08	55.8	254	0.095	0.146	BORG2_MOUSE Cdc42 effector protein 3 OS=Mus musculus OX=10090 GN=Cdc42ep3 PE=1 SV=1
14	O77375	3.99e-07	54.7	2457	0.064	0.010	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1
15	Q9I7F7	1.69e-05	49.7	1337	0.061	0.018	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
16	Q15428	2.05e-04	45.8	464	0.061	0.052	SF3A2_HUMAN Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2
17	A0A8I6ASE2	0.005	41.6	1956	0.056	0.011	A0A8I6ASE2_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
18	D4A5A6	0.005	41.6	1970	0.056	0.011	D4A5A6_RAT DNA-directed RNA polymerase subunit OS=Rattus norvegicus OX=10116 GN=Polr2a PE=1 SV=1
19	G3MZY8	0.005	41.6	1970	0.056	0.011	G3MZY8_BOVIN DNA-directed RNA polymerase subunit OS=Bos taurus OX=9913 GN=POLR2A PE=1 SV=2
20	P08775	0.005	41.6	1970	0.056	0.011	RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus OX=10090 GN=Polr2a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14957 BORG_CEP	1.4e-09	50.5	Cdc42 effector
2	PF00786 PBD	0.0093	27.6	P21-Rho-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249014

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.930	Cell division control protein 42 homolog
2	9606.ENSP00000238738	0.831	Rho-related GTP-binding protein RhoQ
3	9606.ENSP00000351206	0.737	Beta-taxilin
4	9606.ENSP00000246112	0.552	Transducin-like enhancer protein 6
5	9606.ENSP00000407118	0.552	Syntabulin
6	9606.ENSP00000467266	0.539	Cytochrome c oxidase subunit 6B2
7	9606.ENSP00000440703	0.504	Nuclear pore complex interacting protein family member B5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.953	cell adhesion molecule binding
GO:0045296	0.941	cadherin binding
GO:0098631	0.925	cell adhesion mediator activity
GO:0098632	0.922	cell-cell adhesion mediator activity
GO:0098641	0.627	cadherin binding involved in cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0120034	0.988	positive regulation of plasma membrane bounded cell projection assembly
GO:0022604	0.935	regulation of cell morphogenesis
GO:0008360	0.838	regulation of cell shape
GO:0009987	0.815	cellular process
GO:0050896	0.421	response to stimulus
GO:0031274	0.324	positive regulation of pseudopodium assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.993	cytosol
GO:0043226	0.789	organelle
GO:0030054	0.788	cell junction
GO:0070161	0.771	anchoring junction
GO:0043229	0.723	intracellular organelle
GO:0030055	0.699	cell-substrate junction
GO:0005925	0.628	focal adhesion
GO:0005911	0.502	cell-cell junction
GO:0005912	0.446	adherens junction
GO:0043231	0.426	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]