StarFunc result for job id Q00604

User Input

>input (133 residues)
MRKHVLAASFSMLSLLVIMGDTDSKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMV
LLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATY
RYILSCHCEECNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00604	1.000	1.000	5.983E-22	133	1.000	1.000	Q00604.pdb.gz	NDP_HUMAN Norrin OS=Homo sapiens OX=9606 GN=NDP PE=1 SV=1
2	AFDB:E7F073	0.749	0.723	2.577E-16	138	0.647	0.623	E7F073.pdb.gz
3	PDB:4my2A	0.724	0.214	6.204E-16	474	0.782	0.219	4my2A.pdb.gz	Structure and function of Norrin in assembly and activation of a Frizzled 4-Lrp5/6 complex.
4	AFDB:Q58L88	0.564	0.536	2.279E-6	141	0.248	0.234	Q58L88.pdb.gz	Q58L88_DROME Glycoprotein hormone alpha 2 OS=Drosophila melanogaster OX=7227 GN=Gpa2 PE=2 SV=1
5	AFDB:Q98UI9	0.549	0.041	2.802E-5	2108	0.195	0.012	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
6	AFDB:Q9VJS7	0.422	0.401	4.779E-5	141	0.203	0.191	Q9VJS7.pdb.gz	PBURS_DROME Partner of bursicon OS=Drosophila melanogaster OX=7227 GN=Pburs PE=1 SV=1
7	AFDB:Q9VD83	0.535	0.422	5.318E-5	173	0.233	0.179	Q9VD83.pdb.gz	BURS_DROME Bursicon OS=Drosophila melanogaster OX=7227 GN=Burs PE=1 SV=1
8	AFDB:Q9CV93	0.510	0.108	6.945E-5	725	0.180	0.033	Q9CV93.pdb.gz	Q9CV93_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
9	AFDB:Q21013	0.527	0.569	1.064E-4	122	0.158	0.172	Q21013.pdb.gz	Q21013_CAEEL Bursicon OS=Caenorhabditis elegans OX=6239 GN=flr-2 PE=4 SV=2
10	AFDB:A2VB89	0.535	0.471	1.123E-4	153	0.165	0.144	A2VB89.pdb.gz	BURS_APIME Bursicon OS=Apis mellifera OX=7460 GN=burs PE=2 SV=1
11	AFDB:O88273	0.561	0.454	2.020E-4	168	0.180	0.143	O88273.pdb.gz	GREM2_MOUSE Gremlin-2 OS=Mus musculus OX=10090 GN=Grem2 PE=1 SV=1
12	PDB:5hk5F	0.505	0.518	8.295E-4	129	0.195	0.202	5hk5F.pdb.gz
13	PDB:2k8pA	0.429	0.323	2.056E-3	189	0.203	0.143	2k8pA.pdb.gz
14	PDB:1hcnB	0.519	0.612	5.669E-3	110	0.143	0.173	1hcnB.pdb.gz
15	PDB:4mqwB	0.466	0.556	7.810E-3	109	0.128	0.156	4mqwB.pdb.gz
16	PDB:7t9iB	0.426	0.508	8.690E-3	109	0.135	0.165	7t9iB.pdb.gz
17	PDB:6q2sA	0.409	0.529	1.332E-2	98	0.143	0.194	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
18	PDB:5vqfB	0.387	0.176	6.265E-2	320	0.135	0.056	5vqfB.pdb.gz
19	PDB:3rjrC	0.400	0.171	7.756E-2	343	0.128	0.050	3rjrC.pdb.gz
20	PDB:1wq8A	0.432	0.540	1.127E-1	100	0.098	0.130	1wq8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00604	3.46e-94	269	133	1.000	1.000	NDP_HUMAN Norrin OS=Homo sapiens OX=9606 GN=NDP PE=1 SV=1
2	D3ZEP2	2.95e-86	249	131	0.940	0.954	D3ZEP2_RAT Norrin cystine knot growth factor NDP OS=Rattus norvegicus OX=10116 GN=Ndp PE=4 SV=1
3	P48744	2.95e-86	249	131	0.940	0.954	NDP_MOUSE Norrin OS=Mus musculus OX=10090 GN=Ndp PE=1 SV=1
4	Q7Z5P9	1.26e-05	45.4	8384	0.158	0.003	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
5	Q02817	7.20e-04	40.4	5179	0.188	0.005	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
6	Q6PZE0	0.001	40.0	7524	0.165	0.003	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
7	Q80Z19	0.14	33.9	2680	0.150	0.007	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
8	Q91ZX5	0.17	32.3	105	0.158	0.200	Q91ZX5_MOUSE MUC5B (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
9	Q6W4X9	0.30	32.7	2439	0.188	0.010	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
10	Q5VIR6	0.61	32.0	832	0.090	0.014	VPS53_HUMAN Vacuolar protein sorting-associated protein 53 homolog OS=Homo sapiens OX=9606 GN=VPS53 PE=1 SV=2
11	Q8K1G6	0.62	32.0	4782	0.158	0.004	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
12	E9Q5I3	0.63	32.0	4800	0.158	0.004	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
13	Q8CCB4	0.63	32.0	832	0.090	0.014	VPS53_MOUSE Vacuolar protein sorting-associated protein 53 homolog OS=Mus musculus OX=10090 GN=Vps53 PE=1 SV=1
14	D3ZPE5	0.69	31.6	832	0.090	0.014	D3ZPE5_RAT Vacuolar protein sorting-associated protein 53 homolog OS=Rattus norvegicus OX=10116 GN=Vps53 PE=1 SV=1
15	Q9CV93	0.71	31.6	725	0.158	0.029	Q9CV93_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
16	E1JJD1	0.85	31.6	581	0.150	0.034	E1JJD1_DROME Mnt, isoform G OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
17	M9NDN0	0.85	31.6	583	0.150	0.034	M9NDN0_DROME Mnt, isoform J OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
18	Q8SY46	0.85	31.6	582	0.150	0.034	Q8SY46_DROME GH28809p OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
19	X2JDM5	0.90	31.6	716	0.150	0.028	X2JDM5_DROME Mnt, isoform K OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
20	D0E2W2	1.0	31.2	338	0.158	0.062	D0E2W2_DANRE Cellular communication network factor 6 OS=Danio rerio OX=7955 GN=si:dkey-119m7.6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00007 Cys_knot	0.0024	29.5	Cystine-knot domain
2	PF03045 DAN	0.041	25.3	DAN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010351149.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010354330.1	0.992	Belongs to the G-protein coupled receptor Fz/Smo family.
2	61622.XP_010353283.1	0.800	Belongs to the G-protein coupled receptor Fz/Smo family.
3	61622.XP_010372836.1	0.782	Leucine rich repeat containing G protein-coupled receptor 4
4	61622.XP_010364779.1	0.748	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.
5	61622.XP_010380597.1	0.736	Tetraspanin-12
6	61622.XP_010385756.1	0.721	Belongs to the G-protein coupled receptor Fz/Smo family.
7	61622.XP_010383616.1	0.699	Adhesion G protein-coupled receptor A2
8	61622.XP_010374535.1	0.610	Sclerostin
9	61622.XP_010352954.1	0.588	Frizzled-1
10	61622.XP_010378037.1	0.561	SCO-spondin
11	61622.XP_010363153.1	0.557	Tyrosine-protein kinase RYK
12	61622.XP_010376457.1	0.549	Belongs to the intermediate filament family.
13	61622.XP_010377177.1	0.545	Leucine rich repeat containing G protein-coupled receptor 6
14	61622.XP_010352284.1	0.541	Belongs to the G-protein coupled receptor Fz/Smo family.
15	61622.XP_010385200.1	0.528	Belongs to the G-protein coupled receptor Fz/Smo family.
16	61622.XP_010361717.1	0.518	IL2 inducible T-cell kinase
17	61622.XP_010369300.1	0.502	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005109	1.000	frizzled binding
GO:0005125	1.000	cytokine activity
GO:0046983	0.995	protein dimerization activity
GO:0042802	0.925	identical protein binding
GO:0042803	0.781	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0048856	0.986	anatomical structure development
GO:0009987	0.985	cellular process
GO:0050789	0.985	regulation of biological process
GO:0050896	0.983	response to stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0007166	0.972	cell surface receptor signaling pathway
GO:0048513	0.966	animal organ development
GO:0007267	0.959	cell-cell signaling
GO:0007275	0.949	multicellular organism development
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0031325	0.923	positive regulation of cellular metabolic process
GO:0051171	0.917	regulation of nitrogen compound metabolic process
GO:0048731	0.914	system development
GO:0080090	0.909	regulation of primary metabolic process
GO:1905114	0.906	cell surface receptor signaling pathway involved in cell-cell signaling
GO:0051252	0.893	regulation of RNA metabolic process
GO:0009889	0.884	regulation of biosynthetic process
GO:0051173	0.855	positive regulation of nitrogen compound metabolic process
GO:0009891	0.851	positive regulation of biosynthetic process
GO:0045935	0.850	positive regulation of nucleobase-containing compound metabolic process
GO:2001141	0.847	regulation of RNA biosynthetic process
GO:0001890	0.795	placenta development
GO:0010468	0.776	regulation of gene expression
GO:0010604	0.746	positive regulation of macromolecule metabolic process
GO:0006355	0.703	regulation of DNA-templated transcription
GO:0060041	0.691	retina development in camera-type eye
GO:0072359	0.674	circulatory system development
GO:1903508	0.646	positive regulation of nucleic acid-templated transcription
GO:0045893	0.643	positive regulation of DNA-templated transcription
GO:0001944	0.604	vasculature development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0005576	0.984	extracellular region
GO:0005886	0.934	plasma membrane
GO:0005615	0.924	extracellular space
GO:0009986	0.726	cell surface
GO:0005737	0.426	cytoplasm
GO:0043227	0.373	membrane-bounded organelle
GO:0043229	0.365	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]