StarFunc result for job id Q00610

User Input

>input (1675 residues)
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1xi4A	0.297	0.304	0.000	1630	0.973	1.000	1xi4A.pdb.gz
2	AFDB:P11442	0.884	0.884	0.000	1675	0.997	0.997	P11442.pdb.gz	CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=3
3	AFDB:P22137	0.324	0.328	0.000	1653	0.491	0.498	P22137.pdb.gz	CLH_YEAST Clathrin heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHC1 PE=1 SV=1
4	AFDB:P25870	0.369	0.366	0.000	1694	0.576	0.570	P25870.pdb.gz	CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum OX=44689 GN=chcA PE=1 SV=1
5	AFDB:P29742	0.849	0.848	0.000	1678	0.797	0.796	P29742.pdb.gz	CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster OX=7227 GN=Chc PE=1 SV=1
6	AFDB:P34574	0.402	0.401	0.000	1681	0.713	0.710	P34574.pdb.gz	CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=chc-1 PE=1 SV=1
7	AFDB:P53675	0.417	0.426	0.000	1640	0.828	0.846	P53675.pdb.gz	CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1 PE=1 SV=2
8	AFDB:Q0WNJ6	0.368	0.362	0.000	1705	0.560	0.550	Q0WNJ6.pdb.gz	CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana OX=3702 GN=CHC1 PE=1 SV=1
9	AFDB:Q10161	0.512	0.514	0.000	1666	0.550	0.553	Q10161.pdb.gz	CLH_SCHPO Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chc1 PE=1 SV=1
10	AFDB:Q38B01	0.527	0.520	0.000	1703	0.393	0.387	Q38B01.pdb.gz	Q38B01_TRYB2 Clathrin heavy chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0830 PE=3 SV=1
11	AFDB:J3KS13	0.254	0.648	2.597E-53	612	0.306	0.837	J3KS13.pdb.gz	J3KS13_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
12	PDB:7qpgR	0.114	0.093	2.296E-12	2208	0.143	0.108	7qpgR.pdb.gz
13	PDB:4bujB	0.079	0.091	6.956E-12	1367	0.092	0.113	4bujB.pdb.gz
14	PDB:6qk7A	0.133	0.181	1.143E-11	1161	0.071	0.102	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
15	PDB:7zu0A	0.166	0.268	3.598E-11	954	0.069	0.121	7zu0A.pdb.gz
16	PDB:7r5jK0	0.143	0.208	1.861E-10	1086	0.075	0.116	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7vciR	0.138	0.202	2.727E-10	1082	0.094	0.146	7vciR.pdb.gz
18	PDB:7r5jT0	0.147	0.228	2.067E-9	1004	0.075	0.125	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7sqcR1	0.101	0.085	3.147E-9	2080	0.108	0.087	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:7qdrB	0.099	0.127	3.667E-9	1212	0.094	0.130	7qdrB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WVQ6	0.0	3481	1679	0.999	0.997	A0A087WVQ6_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
2	C0MHR2	0.0	3487	1675	1.000	1.000	C0MHR2_PIG Clathrin heavy chain OS=Sus scrofa OX=9823 GN=CLTC PE=1 SV=1
3	J3KS13	0.0	1058	612	0.306	0.838	J3KS13_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=1
4	K7EJJ5	0.0	3481	1682	1.000	0.996	K7EJJ5_HUMAN Clathrin heavy chain OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=2
5	P11442	0.0	3477	1675	0.998	0.998	CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=3
6	P22137	0.0	1652	1653	0.491	0.498	CLH_YEAST Clathrin heavy chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHC1 PE=1 SV=1
7	P25870	0.0	2006	1694	0.582	0.576	CLH_DICDI Clathrin heavy chain OS=Dictyostelium discoideum OX=44689 GN=chcA PE=1 SV=1
8	P29742	0.0	2810	1678	0.796	0.795	CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster OX=7227 GN=Chc PE=1 SV=1
9	P34574	0.0	2525	1681	0.712	0.709	CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=chc-1 PE=1 SV=1
10	P49951	0.0	3484	1675	0.999	0.999	CLH1_BOVIN Clathrin heavy chain 1 OS=Bos taurus OX=9913 GN=CLTC PE=1 SV=1
11	P53675	0.0	2884	1640	0.829	0.847	CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens OX=9606 GN=CLTCL1 PE=1 SV=2
12	Q00610	0.0	3487	1675	1.000	1.000	CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5
13	Q0WLB5	0.0	1930	1703	0.559	0.550	CLAH2_ARATH Clathrin heavy chain 2 OS=Arabidopsis thaliana OX=3702 GN=CHC2 PE=1 SV=1
14	Q0WNJ6	0.0	1918	1705	0.556	0.547	CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana OX=3702 GN=CHC1 PE=1 SV=1
15	Q10161	0.0	1919	1666	0.549	0.552	CLH_SCHPO Probable clathrin heavy chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chc1 PE=1 SV=1
16	Q38B01	0.0	1268	1703	0.396	0.390	Q38B01_TRYB2 Clathrin heavy chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0830 PE=3 SV=1
17	Q68FD5	0.0	3485	1675	0.999	0.999	CLH1_MOUSE Clathrin heavy chain 1 OS=Mus musculus OX=10090 GN=Cltc PE=1 SV=3
18	Q49AL0	6.26e-21	89.4	36	0.021	1.000	Q49AL0_HUMAN CLTC protein OS=Homo sapiens OX=9606 GN=CLTC PE=2 SV=1
19	Q8NHS4	4.30e-11	70.1	586	0.029	0.084	CLHC1_HUMAN Clathrin heavy chain linker domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CLHC1 PE=1 SV=3
20	Q01163	0.78	36.6	450	0.012	0.044	RT23_YEAST Small ribosomal subunit protein mS29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSM23 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	4e+02	12.7	Anaphase-promoting complex, cyclosome, subunit 3
2	PF00637 Clathrin	5.5e-205	682.9	Region in Clathrin and VPS
3	PF09268 Clathrin-link	4.7e-11	53.1	Clathrin, heavy-chain linker
4	PF13838 Clathrin_H_link	1.1e-28	110.3	Clathrin-H-link
5	PF01394 Clathrin_propel	3.9e-47	167.5	Clathrin propeller repeat
6	PF04053 Coatomer_WDAD	0.00039	31.3	Coatomer WD associated region
7	PF00515 TPR_1	2.9	19.0	Tetratricopeptide repeat
8	PF13428 TPR_14	0.42	22.5	Tetratricopeptide repeat
9	PF14559 TPR_19	1.4	20.7	Tetratricopeptide repeat
10	PF07719 TPR_2	11	17.4	Tetratricopeptide repeat
11	PF13176 TPR_7	0.17	23.0	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 42254.XP_004608674.1

Rank	PPI partner	STRING score	Description
1	42254.XP_004600292.1	0.999	Clathrin light chain A isoform X1
2	42254.XP_004617496.1	0.997	cyclin-G-associated kinase
3	42254.XP_004611584.1	0.996	Clathrin light chain B
4	42254.XP_004620720.1	0.995	Beta-arrestin-1
5	42254.XP_004607337.1	0.994	Putative tyrosine-protein phosphatase auxilin
6	42254.XP_004608904.1	0.991	AP-1 complex subunit beta-1
7	42254.XP_004622452.1	0.991	AP-2 complex subunit beta-like
8	42254.XP_004602939.1	0.987	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 Proteins
9	42254.XP_004619904.1	0.986	AP-2 complex subunit alpha-1 isoform X1
10	42254.XP_004620934.1	0.986	Huntingtin-interacting protein 1
11	42254.XP_004603117.1	0.981	Upstream in-frame stop codon
12	42254.XP_004607767.1	0.975	AP-2 complex subunit sigma isoform X1
13	42254.XP_004600602.1	0.971	AP-1 complex subunit gamma-1 isoform X1
14	42254.XP_004608916.1	0.966	Synergin gamma
15	42254.XP_004606332.1	0.963	Sodium channel and clathrin linker 1
16	42254.XP_004604970.1	0.961	Beta-arrestin-2 isoform X1
17	42254.XP_004609209.1	0.958	AP2-associated protein kinase 1
18	42254.XP_004620920.1	0.952	AP-1 complex subunit sigma-1A
19	42254.XP_004607197.1	0.948	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 11 Proteins
20	42254.XP_004614620.1	0.946	Sodium channel protein type 10 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019904	0.414	protein domain specific binding
GO:0019899	0.314	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0016192	0.975	vesicle-mediated transport
GO:0006897	0.938	endocytosis
GO:0051641	0.935	cellular localization
GO:0071840	0.916	cellular component organization or biogenesis
GO:0016043	0.898	cellular component organization
GO:0051649	0.893	establishment of localization in cell
GO:0065007	0.846	biological regulation
GO:0050789	0.823	regulation of biological process
GO:0050794	0.736	regulation of cellular process
GO:0015031	0.555	protein transport
GO:0046907	0.540	intracellular transport
GO:0006898	0.482	receptor-mediated endocytosis
GO:0044085	0.471	cellular component biogenesis
GO:0022607	0.460	cellular component assembly
GO:0032502	0.451	developmental process
GO:0048518	0.366	positive regulation of biological process
GO:0006996	0.358	organelle organization
GO:0032879	0.336	regulation of localization
GO:0048522	0.316	positive regulation of cellular process
GO:0048856	0.311	anatomical structure development
GO:0032501	0.306	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0012505	0.997	endomembrane system
GO:0031410	0.997	cytoplasmic vesicle
GO:0071944	0.996	cell periphery
GO:0043228	0.986	non-membrane-bounded organelle
GO:0030136	0.978	clathrin-coated vesicle
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005886	0.971	plasma membrane
GO:0005819	0.967	spindle
GO:0032991	0.958	protein-containing complex
GO:0005829	0.949	cytosol
GO:0030054	0.822	cell junction
GO:0072686	0.767	mitotic spindle
GO:0031090	0.745	organelle membrane
GO:0048475	0.674	coated membrane
GO:0005773	0.659	vacuole
GO:0030117	0.647	membrane coat
GO:0098588	0.588	bounding membrane of organelle
GO:0005768	0.536	endosome
GO:0005794	0.530	Golgi apparatus
GO:0098590	0.448	plasma membrane region
GO:0005905	0.370	clathrin-coated pit
GO:0045334	0.360	clathrin-coated endocytic vesicle
GO:0030118	0.358	clathrin coat
GO:0005576	0.352	extracellular region
GO:0030662	0.349	coated vesicle membrane
GO:0000323	0.341	lytic vacuole
GO:0030665	0.325	clathrin-coated vesicle membrane
GO:0005764	0.324	lysosome
GO:0070013	0.316	intracellular organelle lumen
GO:0031981	0.309	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]