StarFunc result for job id Q00613

User Input

>input (529 residues)
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKY
FKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
SVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVHGSGPY
SAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGGSIDERPLSSSPLVRVKEE
PPSPPQSPRVEEASPGRPSSVDTLLSPTALIDSILRESEPAPASVTALTDARGHTDTEGR
PPSPPPTSTPEKCLSVACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSP
SVTVPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTAQPLFLLDPGS
VDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTGSEPPKAKDPTVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00613	1.000	1.000	1.067E-82	529	1.000	1.000	Q00613.pdb.gz	HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1
2	AFDB:F1MAF1	0.401	0.404	1.195E-70	525	0.898	0.905	F1MAF1.pdb.gz	F1MAF1_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=1 SV=2
3	AFDB:E9PMQ6	0.269	0.287	1.022E-61	495	0.836	0.893	E9PMQ6.pdb.gz	E9PMQ6_HUMAN Heat shock transcription factor 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=2
4	AFDB:Q63717	0.175	0.203	2.054E-47	448	0.750	0.886	Q63717.pdb.gz	Q63717_RAT Heat shock transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=2 SV=1
5	AFDB:Q9IAS1	0.340	0.350	2.665E-46	512	0.588	0.607	Q9IAS1.pdb.gz
6	AFDB:Q76M54	0.355	0.373	5.394E-46	501	0.556	0.587	Q76M54.pdb.gz	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
7	AFDB:Q9IAS0	0.365	0.360	9.005E-46	538	0.577	0.567	Q9IAS0.pdb.gz
8	AFDB:Q76M53	0.361	0.371	2.071E-45	513	0.580	0.598	Q76M53.pdb.gz	Q76M53_ONCMY Heat shock transcription factor 1 isoform b OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
9	AFDB:P38530	0.349	0.331	5.422E-29	564	0.365	0.342	P38530.pdb.gz	HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus OX=9031 GN=HSF2 PE=2 SV=1
10	AFDB:Q03933	0.363	0.359	1.418E-28	536	0.352	0.347	Q03933.pdb.gz	HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens OX=9606 GN=HSF2 PE=1 SV=1
11	PDB:1z9cC	0.089	0.252	8.765E-1	138	0.030	0.116	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
12	PDB:7a5hU	0.073	0.186	2.149	152	0.017	0.059	7a5hU.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
13	PDB:1f93A	0.086	0.288	2.292	103	0.021	0.107	1f93A.pdb.gz	Structural basis of dimerization, coactivator recognition and MODY3 mutations in HNF-1alpha.
14	PDB:1qk1A	0.084	0.110	3.157	379	0.013	0.018	1qk1A.pdb.gz
15	PDB:3owcA	0.081	0.198	3.366	172	0.021	0.064	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
16	PDB:3h0gK	0.076	0.221	3.589	119	0.025	0.109	3h0gK.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
17	PDB:1qh4D	0.076	0.099	3.826	380	0.017	0.024	1qh4D.pdb.gz	Crystal structure of brain-type creatine kinase at 1.41 A resolution.
18	PDB:4c3kD	0.057	0.208	4.349	101	0.013	0.069	4c3kD.pdb.gz	Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
19	PDB:1bg0A	0.072	0.100	4.944	356	0.017	0.025	1bg0A.pdb.gz	Transition state structure of arginine kinase: implications for catalysis of bimolecular reactions.
20	PDB:3tgoD	0.062	0.125	4.944	186	0.028	0.081	3tgoD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y5J6	0.0	806	505	0.836	0.875	A0A8I5Y5J6_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=3 SV=1
2	A0A8I6ADR2	0.0	615	432	0.641	0.785	A0A8I6ADR2_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=3 SV=1
3	A0A8I6AMW4	0.0	811	531	0.851	0.847	A0A8I6AMW4_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=3 SV=1
4	E9PMQ6	0.0	791	495	0.834	0.891	E9PMQ6_HUMAN Heat shock transcription factor 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=2
5	F1MAF1	0.0	862	553	0.890	0.852	F1MAF1_RAT Heat shock transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=1 SV=2
6	F6P697	0.0	555	523	0.595	0.602	F6P697_DANRE Heat shock factor protein 1 isoform X1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=1
7	P38529	0.0	761	491	0.722	0.778	HSF1_CHICK Heat shock factor protein 1 OS=Gallus gallus OX=9031 GN=HSF1 PE=1 SV=1
8	P38532	0.0	909	525	0.898	0.905	HSF1_MOUSE Heat shock factor protein 1 OS=Mus musculus OX=10090 GN=Hsf1 PE=1 SV=2
9	Q00613	0.0	1072	529	1.000	1.000	HSF1_HUMAN Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1
10	Q1LXV0	0.0	572	497	0.597	0.636	Q1LXV0_DANRE Heat shock factor protein 1 OS=Danio rerio OX=7955 GN=HSF PE=1 SV=2
11	Q63717	0.0	721	448	0.752	0.888	Q63717_RAT Heat shock transcription factor 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Hsf1 PE=2 SV=1
12	Q76M53	0.0	561	513	0.569	0.587	Q76M53_ONCMY Heat shock transcription factor 1 isoform b OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
13	Q76M54	0.0	535	501	0.552	0.583	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
14	Q5CZP2	4.93e-120	362	441	0.391	0.469	HSF4_DANRE Heat shock factor protein 4 OS=Danio rerio OX=7955 GN=hsf4 PE=2 SV=2
15	Q9HAV2	7.14e-105	313	159	0.299	0.994	Q9HAV2_HUMAN Heat shock transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
16	P38530	2.44e-94	300	564	0.367	0.344	HSF2_CHICK Heat shock factor protein 2 OS=Gallus gallus OX=9031 GN=HSF2 PE=2 SV=1
17	Q03933	2.12e-93	296	536	0.353	0.349	HSF2_HUMAN Heat shock factor protein 2 OS=Homo sapiens OX=9606 GN=HSF2 PE=1 SV=1
18	P38533	4.54e-93	295	535	0.363	0.359	HSF2_MOUSE Heat shock factor protein 2 OS=Mus musculus OX=10090 GN=Hsf2 PE=1 SV=2
19	Q90XA8	4.81e-90	286	489	0.353	0.382	Q90XA8_DANRE Heat shock factor Hsf2 OS=Danio rerio OX=7955 GN=zfHSF2 PE=2 SV=1
20	P38531	4.27e-88	280	467	0.333	0.377	HSF3_CHICK Heat shock factor protein 3 OS=Gallus gallus OX=9031 GN=HSF3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00447 HSF_DNA-bind	7.6e-31	117.9	HSF-type DNA-binding
2	PF06785 UPF0242	3.7e+02	12.6	Uncharacterised protein family (UPF0242) N-terminus
3	PF06546 Vert_HS_TF	5.6e-125	428.2	Vertebrate heat shock transcription factor
4	PF06005 ZapB	26	16.7	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
2	9606.ENSP00000364802	0.993	Heat shock 70 kDa protein 1A
3	9606.ENSP00000302961	0.992	Heat shock protein family A member 4
4	9606.ENSP00000263025	0.977	Mitogen-activated protein kinase 3
5	9606.ENSP00000254322	0.973	DnaJ homolog subfamily B member 1
6	9606.ENSP00000395654	0.965	Transcription activator BRG1
7	9606.ENSP00000339063	0.957	Elongation factor 1-alpha 1
8	9606.ENSP00000432083	0.956	Heat shock cognate 71 kDa protein
9	9606.ENSP00000433560	0.950	Alpha-crystallin B chain
10	9606.ENSP00000215832	0.949	Mitogen-activated protein kinase 1
11	9606.ENSP00000360609	0.949	Heat shock protein HSP 90-beta
12	9606.ENSP00000262367	0.947	CREB-binding protein
13	9606.ENSP00000324806	0.945	Glycogen synthase kinase-3 beta
14	9606.ENSP00000263253	0.944	Histone acetyltransferase p300
15	9606.ENSP00000334061	0.941	Histone deacetylase 6
16	9606.ENSP00000358081	0.934	BAG family molecular chaperone regulator 3
17	9606.ENSP00000281938	0.931	Heat shock protein beta-8
18	9606.ENSP00000356070	0.929	MAP kinase-activated protein kinase 2
19	9606.ENSP00000482075	0.928	Prostaglandin E synthase 3
20	9606.ENSP00000354558	0.926	Serine/threonine-protein kinase mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	1.000	chromatin binding
GO:0031072	1.000	heat shock protein binding
GO:0043565	1.000	sequence-specific DNA binding
GO:0061629	0.999	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000976	0.984	transcription cis-regulatory region binding
GO:0097677	0.981	STAT family protein binding
GO:0098847	0.977	sequence-specific single stranded DNA binding
GO:1990841	0.976	promoter-specific chromatin binding
GO:0042802	0.960	identical protein binding
GO:0000987	0.954	cis-regulatory region sequence-specific DNA binding
GO:0019899	0.934	enzyme binding
GO:0000977	0.926	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.917	transcription regulator activity
GO:0003700	0.884	DNA-binding transcription factor activity
GO:0046983	0.814	protein dimerization activity
GO:0000978	0.808	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.684	DNA-binding transcription activator activity
GO:0000981	0.668	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.613	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019900	0.510	kinase binding
GO:0019901	0.493	protein kinase binding
GO:0031490	0.475	chromatin DNA binding
GO:0051879	0.470	Hsp90 protein binding
GO:0140296	0.444	general transcription initiation factor binding
GO:0046982	0.414	protein heterodimerization activity
GO:0043621	0.380	protein self-association
GO:0001227	0.367	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.977	response to stimulus
GO:0009987	0.977	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0009628	0.970	response to abiotic stimulus
GO:0048522	0.967	positive regulation of cellular process
GO:0048519	0.964	negative regulation of biological process
GO:0051716	0.958	cellular response to stimulus
GO:0019219	0.958	regulation of nucleobase-containing compound metabolic process
GO:0042221	0.956	response to chemical
GO:0009408	0.955	response to heat
GO:0009889	0.939	regulation of biosynthetic process
GO:0048523	0.938	negative regulation of cellular process
GO:0031326	0.934	regulation of cellular biosynthetic process
GO:0010556	0.931	regulation of macromolecule biosynthetic process
GO:0065009	0.919	regulation of molecular function
GO:0051054	0.911	positive regulation of DNA metabolic process
GO:0031331	0.910	positive regulation of cellular catabolic process
GO:0070887	0.908	cellular response to chemical stimulus
GO:0033554	0.901	cellular response to stress
GO:0010033	0.900	response to organic substance
GO:0051252	0.889	regulation of RNA metabolic process
GO:0045862	0.888	positive regulation of proteolysis
GO:0051098	0.887	regulation of binding
GO:0044087	0.887	regulation of cellular component biogenesis
GO:0043069	0.877	negative regulation of programmed cell death
GO:0006355	0.875	regulation of DNA-templated transcription
GO:0044093	0.872	positive regulation of molecular function
GO:0043066	0.865	negative regulation of apoptotic process
GO:0009892	0.861	negative regulation of metabolic process
GO:0010628	0.860	positive regulation of gene expression
GO:0000302	0.848	response to reactive oxygen species
GO:0051099	0.846	positive regulation of binding
GO:0052547	0.846	regulation of peptidase activity
GO:0043085	0.845	positive regulation of catalytic activity
GO:0043393	0.839	regulation of protein binding
GO:0010952	0.839	positive regulation of peptidase activity
GO:0010035	0.837	response to inorganic substance
GO:0104004	0.835	cellular response to environmental stimulus
GO:0010660	0.829	regulation of muscle cell apoptotic process
GO:0051174	0.828	regulation of phosphorus metabolic process
GO:0052548	0.824	regulation of endopeptidase activity
GO:0051128	0.822	regulation of cellular component organization
GO:0010605	0.822	negative regulation of macromolecule metabolic process
GO:1901701	0.819	cellular response to oxygen-containing compound
GO:0034605	0.819	cellular response to heat
GO:0019220	0.816	regulation of phosphate metabolic process
GO:2000116	0.810	regulation of cysteine-type endopeptidase activity
GO:0071375	0.810	cellular response to peptide hormone stimulus
GO:0010950	0.808	positive regulation of endopeptidase activity
GO:0010656	0.802	negative regulation of muscle cell apoptotic process
GO:1990776	0.796	response to angiotensin
GO:0010664	0.792	negative regulation of striated muscle cell apoptotic process
GO:0008152	0.776	metabolic process
GO:0032092	0.775	positive regulation of protein binding
GO:0071392	0.769	cellular response to estradiol stimulus
GO:1904385	0.768	cellular response to angiotensin
GO:0009605	0.767	response to external stimulus
GO:2001056	0.764	positive regulation of cysteine-type endopeptidase activity
GO:0001101	0.761	response to acid chemical
GO:0031399	0.750	regulation of protein modification process
GO:0010667	0.739	negative regulation of cardiac muscle cell apoptotic process
GO:0071704	0.734	organic substance metabolic process
GO:1901654	0.732	response to ketone
GO:0070482	0.729	response to oxygen levels
GO:0032496	0.709	response to lipopolysaccharide
GO:0044238	0.648	primary metabolic process
GO:0044237	0.646	cellular metabolic process
GO:0071248	0.630	cellular response to metal ion
GO:0006807	0.619	nitrogen compound metabolic process
GO:0071478	0.617	cellular response to radiation
GO:0071840	0.554	cellular component organization or biogenesis
GO:0051129	0.550	negative regulation of cellular component organization
GO:0010557	0.548	positive regulation of macromolecule biosynthetic process
GO:0031328	0.541	positive regulation of cellular biosynthetic process
GO:0043170	0.521	macromolecule metabolic process
GO:1902075	0.513	cellular response to salt
GO:0016043	0.512	cellular component organization
GO:0051254	0.488	positive regulation of RNA metabolic process
GO:0010629	0.482	negative regulation of gene expression
GO:0048583	0.462	regulation of response to stimulus
GO:0007154	0.405	cell communication
GO:0023052	0.400	signaling
GO:0007165	0.387	signal transduction
GO:0031324	0.374	negative regulation of cellular metabolic process
GO:0051172	0.371	negative regulation of nitrogen compound metabolic process
GO:1902680	0.357	positive regulation of RNA biosynthetic process
GO:0080134	0.329	regulation of response to stress
GO:0006357	0.317	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005694	0.971	chromosome
GO:0070013	0.945	intracellular organelle lumen
GO:0031981	0.936	nuclear lumen
GO:0005654	0.929	nucleoplasm
GO:0032991	0.881	protein-containing complex
GO:0000785	0.650	chromatin
GO:0016604	0.374	nuclear body
GO:0012505	0.315	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]