StarFunc result for job id Q00653

User Input

>input (900 residues)
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGIC
AVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPGGGGGAQMAATVPSRDSGEEA
AEPSAPSRTPQCEPQAPEMLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LTAQDENGDTPLHLAIIHGQTSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQT
SVVSFLLRVGADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLVTHLVTKLRAN
VNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEEPLCPLPSPPTSDSDSDSEGP
EKDTRSSFRGHTPLDLTCSTKVKTLLLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGL
EEGVRLLRGPETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00653	1.000	1.000	0.000	900	1.000	1.000	Q00653.pdb.gz	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
2	AFDB:A0A2R8RJY5	0.577	0.600	1.106E-82	863	0.458	0.477	A0A2R8RJY5.pdb.gz
3	AFDB:P25799	0.405	0.378	2.543E-81	971	0.451	0.418	P25799.pdb.gz	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
4	AFDB:Q04861	0.595	0.550	9.028E-80	983	0.432	0.396	Q04861.pdb.gz	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
5	AFDB:P19838	0.371	0.346	1.095E-79	968	0.448	0.416	P19838.pdb.gz	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
6	AFDB:Q94527	0.315	0.293	5.378E-45	971	0.240	0.222	Q94527.pdb.gz	NFKB1_DROME Nuclear factor NF-kappa-B p110 subunit OS=Drosophila melanogaster OX=7227 GN=Rel PE=1 SV=1
7	AFDB:P16236	0.311	0.462	1.456E-34	598	0.166	0.249	P16236.pdb.gz	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
8	AFDB:Q6DGE6	0.305	0.457	2.041E-34	596	0.162	0.245	Q6DGE6.pdb.gz	Q6DGE6_DANRE Proto-oncogene c-Rel OS=Danio rerio OX=7955 GN=c-rel PE=1 SV=1
9	AFDB:P15307	0.308	0.465	5.103E-34	587	0.173	0.266	P15307.pdb.gz	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
10	AFDB:Q04206	0.300	0.480	6.189E-34	551	0.171	0.279	Q04206.pdb.gz	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2
11	PDB:2dvwA	0.228	0.826	1.691E-11	229	0.073	0.288	2dvwA.pdb.gz
12	PDB:8cs9A	0.214	0.238	2.874E-11	796	0.101	0.114	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
13	PDB:6v9hC	0.233	0.707	4.494E-10	270	0.084	0.281	6v9hC.pdb.gz
14	PDB:4oauC	0.196	0.246	1.299E-9	692	0.081	0.105	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:5vkqA	0.215	0.136	5.793E-9	1499	0.073	0.044	5vkqA.pdb.gz
16	PDB:1wg0A	0.219	0.719	9.383E-9	243	0.066	0.243	1wg0A.pdb.gz
17	PDB:6aunA	0.208	0.286	1.674E-8	618	0.093	0.136	6aunA.pdb.gz
18	PDB:6jd6B	0.156	0.649	4.449E-7	192	0.062	0.292	6jd6B.pdb.gz
19	PDB:6v9xA	0.198	0.303	3.716E-6	571	0.078	0.123	6v9xA.pdb.gz
20	PDB:6pqpA	0.194	0.277	4.729E-6	615	0.070	0.102	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G6F3	0.0	1530	902	0.900	0.898	A0A8I6G6F3_RAT Nuclear factor kappa B subunit 2 OS=Rattus norvegicus OX=10116 GN=Nfkb2 PE=1 SV=1
2	P19838	0.0	610	968	0.436	0.405	NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens OX=9606 GN=NFKB1 PE=1 SV=2
3	P25799	0.0	635	971	0.443	0.411	NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus OX=10090 GN=Nfkb1 PE=1 SV=2
4	Q00653	0.0	1833	900	1.000	1.000	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
5	Q04861	0.0	634	983	0.417	0.381	NFKB1_CHICK Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus OX=9031 GN=NFKB1 PE=2 SV=2
6	Q0II00	0.0	738	902	0.481	0.480	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
7	Q9WTK5	0.0	1589	899	0.918	0.919	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
8	P15307	3.66e-77	265	587	0.162	0.249	REL_MOUSE Proto-oncogene c-Rel OS=Mus musculus OX=10090 GN=Rel PE=1 SV=2
9	F1M5R1	6.47e-76	260	566	0.153	0.244	F1M5R1_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=3
10	Q63369	7.01e-76	259	522	0.202	0.349	NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit OS=Rattus norvegicus OX=10116 GN=Nfkb1 PE=1 SV=2
11	A0A8I5XW27	1.56e-75	260	585	0.153	0.236	A0A8I5XW27_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
12	A0A8I6ABJ7	1.64e-75	260	595	0.153	0.232	A0A8I6ABJ7_RAT REL proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rel PE=1 SV=1
13	Q04864	8.45e-74	256	619	0.151	0.220	REL_HUMAN Proto-oncogene c-Rel OS=Homo sapiens OX=9606 GN=REL PE=1 SV=1
14	A0A8I6A5H5	1.62e-73	253	550	0.152	0.249	A0A8I6A5H5_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
15	Q2TAM5	1.81e-73	248	377	0.152	0.363	Q2TAM5_HUMAN RELA protein OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
16	A0A087X0W8	1.93e-73	250	448	0.152	0.306	A0A087X0W8_HUMAN RELA proto-oncogene, NF-kB subunit OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=1
17	Q7TQN4	1.94e-73	253	550	0.152	0.249	Q7TQN4_RAT Nuclear factor kappaB subunit p65 OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
18	P16236	2.26e-73	254	598	0.144	0.217	REL_CHICK Proto-oncogene c-Rel OS=Gallus gallus OX=9031 GN=REL PE=1 SV=2
19	A0A8I5ZMV7	2.36e-73	253	557	0.152	0.246	A0A8I5ZMV7_RAT RELA proto-oncogene, NF-kB subunit OS=Rattus norvegicus OX=10116 GN=Rela PE=1 SV=1
20	Q04206	5.09e-73	252	551	0.152	0.249	TF65_HUMAN Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.4e-22	89.6	Ankyrin repeat
2	PF12796 Ank_2	7.5e-29	111.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.7e-19	78.0	Ankyrin repeat
4	PF13637 Ank_4	1e-16	72.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.7e-18	77.7	Ankyrin repeats (many copies)
6	PF00531 Death	0.0004	31.8	Death domain
7	PF16179 RHD_dimer	1.3e-34	129.6	Rel homology dimerisation domain
8	PF00554 RHD_DNA_bind	1.9e-61	218.4	Rel homology DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358983

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221452	0.999	Transcription factor RelB
2	9606.ENSP00000359424	0.999	Inhibitor of nuclear factor kappa-B kinase subunit alpha
3	9606.ENSP00000430684	0.995	Inhibitor of nuclear factor kappa-B kinase subunit beta
4	9606.ENSP00000359206	0.993	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000164227	0.991	B-cell lymphoma 3 protein
6	9606.ENSP00000482657	0.987	Mitogen-activated protein kinase kinase kinase 14
7	9606.ENSP00000216797	0.985	NF-kappa-B inhibitor alpha
8	9606.ENSP00000384273	0.984	Transcription factor p65
9	9606.ENSP00000483825	0.980	NF-kappa-B essential modulator
10	9606.ENSP00000226574	0.975	Nuclear factor NF-kappa-B p105 subunit
11	9606.ENSP00000295025	0.970	Proto-oncogene c-Rel
12	9606.ENSP00000401399	0.969	Myeloid differentiation primary response protein MyD88
13	9606.ENSP00000312988	0.961	NF-kappa-B inhibitor beta
14	9606.ENSP00000263341	0.957	Interleukin-1 beta
15	9606.ENSP00000272317	0.943	Ubiquitin-40S ribosomal protein S27a
16	9606.ENSP00000263339	0.941	Interleukin-1 alpha
17	9606.ENSP00000371067	0.938	Tyrosine-protein kinase JAK2
18	9606.ENSP00000431885	0.926	Non-receptor tyrosine-protein kinase TYK2
19	9606.ENSP00000280357	0.924	Interleukin-18
20	9606.ENSP00000337383	0.922	NACHT, LRR and PYD domains-containing protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.991	transcription regulator activity
GO:0000978	0.990	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.976	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042802	0.457	identical protein binding
GO:0019899	0.411	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0032502	0.984	developmental process
GO:0050794	0.984	regulation of cellular process
GO:0048518	0.952	positive regulation of biological process
GO:0019222	0.952	regulation of metabolic process
GO:0042221	0.925	response to chemical
GO:0009889	0.919	regulation of biosynthetic process
GO:0060255	0.913	regulation of macromolecule metabolic process
GO:0009987	0.911	cellular process
GO:0080090	0.903	regulation of primary metabolic process
GO:0048522	0.889	positive regulation of cellular process
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0051716	0.870	cellular response to stimulus
GO:0010468	0.870	regulation of gene expression
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0031323	0.861	regulation of cellular metabolic process
GO:0051173	0.851	positive regulation of nitrogen compound metabolic process
GO:0044419	0.837	biological process involved in interspecies interaction between organisms
GO:0031326	0.837	regulation of cellular biosynthetic process
GO:0019219	0.837	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.836	regulation of macromolecule biosynthetic process
GO:0009605	0.830	response to external stimulus
GO:0051252	0.829	regulation of RNA metabolic process
GO:0048856	0.827	anatomical structure development
GO:0009607	0.796	response to biotic stimulus
GO:0006355	0.790	regulation of DNA-templated transcription
GO:0010033	0.775	response to organic substance
GO:0023052	0.769	signaling
GO:0007154	0.766	cell communication
GO:0031325	0.759	positive regulation of cellular metabolic process
GO:0007568	0.709	aging
GO:0007165	0.676	signal transduction
GO:0045935	0.668	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.664	positive regulation of cellular biosynthetic process
GO:0010557	0.656	positive regulation of macromolecule biosynthetic process
GO:0051254	0.645	positive regulation of RNA metabolic process
GO:1902680	0.638	positive regulation of RNA biosynthetic process
GO:0006357	0.633	regulation of transcription by RNA polymerase II
GO:0045893	0.626	positive regulation of DNA-templated transcription
GO:0051707	0.602	response to other organism
GO:0032501	0.568	multicellular organismal process
GO:0034097	0.548	response to cytokine
GO:0048583	0.532	regulation of response to stimulus
GO:0032496	0.515	response to lipopolysaccharide
GO:0045944	0.515	positive regulation of transcription by RNA polymerase II
GO:0002376	0.488	immune system process
GO:0048519	0.481	negative regulation of biological process
GO:0006950	0.464	response to stress
GO:0048523	0.445	negative regulation of cellular process
GO:0070887	0.415	cellular response to chemical stimulus
GO:0008152	0.413	metabolic process
GO:0010646	0.358	regulation of cell communication
GO:0023051	0.357	regulation of signaling
GO:0071704	0.350	organic substance metabolic process
GO:0048584	0.322	positive regulation of response to stimulus
GO:0071310	0.315	cellular response to organic substance
GO:0009966	0.305	regulation of signal transduction
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.992	cytosol
GO:0070013	0.964	intracellular organelle lumen
GO:0032991	0.764	protein-containing complex
GO:0031981	0.731	nuclear lumen
GO:0005654	0.617	nucleoplasm
GO:0071159	0.390	NF-kappaB complex
GO:0033257	0.386	Bcl3/NF-kappaB2 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]