StarFunc result for job id Q00722

User Input

>input (1185 residues)
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKAWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGPTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFVSFEFSAQKNRSYVISSFTELKAYDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELGPPGVGGVGACKLGPGKGSRKKRSLP
REESAGAAPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHVAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLERHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
SVRACLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IVA6	0.650	0.619	0.000	1245	0.449	0.427	A0A0R4IVA6.pdb.gz	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
2	AFDB:O89040	0.782	0.783	0.000	1183	0.857	0.858	O89040.pdb.gz	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
3	AFDB:P10687	0.664	0.647	0.000	1216	0.473	0.461	P10687.pdb.gz	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
4	AFDB:P51432	0.644	0.619	0.000	1234	0.461	0.442	P51432.pdb.gz	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
5	AFDB:Q00722	1.000	1.000	0.000	1185	1.000	1.000	Q00722.pdb.gz	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
6	AFDB:Q91086	0.712	0.699	0.000	1211	0.701	0.686	Q91086.pdb.gz	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
7	AFDB:P25455	0.630	0.568	5.468E-100	1318	0.381	0.343	P25455.pdb.gz	PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster OX=7227 GN=Plc21C PE=2 SV=3
8	PDB:4gnkB	0.635	0.973	1.340E-94	769	0.376	0.580	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
9	AFDB:P13217	0.627	0.678	1.106E-93	1095	0.326	0.353	P13217.pdb.gz	PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4
10	AFDB:Q15147	0.618	0.623	1.421E-91	1175	0.340	0.343	Q15147.pdb.gz	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
11	AFDB:G5EBH0	0.624	0.520	6.989E-87	1431	0.341	0.282	G5EBH0.pdb.gz	PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1
12	PDB:1cjyA	0.088	0.161	2.629E-5	633	0.020	0.038	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:7lq1A	0.089	0.109	7.821E-5	950	0.029	0.036	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
14	PDB:6pyuA	0.090	0.113	2.107E-4	930	0.023	0.029	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
15	PDB:5iz5A	0.090	0.138	4.217E-4	757	0.020	0.032	5iz5A.pdb.gz
16	PDB:5ixcA	0.082	0.138	4.657E-4	684	0.020	0.035	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5izrC	0.084	0.147	4.893E-4	659	0.022	0.039	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:3pfqA	0.071	0.150	1.775E-3	523	0.024	0.054	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
19	PDB:5itdA	0.088	0.103	2.164E-3	995	0.029	0.034	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
20	PDB:7o4i1	0.079	0.161	3.380E-3	522	0.033	0.075	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVA6	968	1245	0.462	0.440	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
2	A2AT91	673	883	0.303	0.407	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
3	A2TJ25	969	1244	0.462	0.440	A2TJ25_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=1
4	A3KGF7	2054	1181	0.859	0.862	PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus OX=10090 GN=Plcb2 PE=1 SV=1
5	G1MWY7	1419	907	0.580	0.757	G1MWY7_MELGA Phosphoinositide phospholipase C OS=Meleagris gallopavo OX=9103 PE=4 SV=2
6	O89040	2051	1183	0.858	0.860	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
7	P10687	1031	1216	0.474	0.462	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
8	P10894	1028	1216	0.474	0.462	PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus OX=9913 GN=PLCB1 PE=1 SV=1
9	P13217	621	1095	0.332	0.360	PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4
10	P51432	988	1234	0.447	0.429	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
11	Q00722	2454	1185	1.000	1.000	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
12	Q01970	1021	1234	0.470	0.451	PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3 PE=1 SV=2
13	Q15147	699	1175	0.354	0.357	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
14	Q5FWA6	669	892	0.301	0.400	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
15	Q91086	1651	1211	0.699	0.684	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
16	Q91UZ1	703	1175	0.359	0.362	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
17	Q99JE6	955	1234	0.438	0.421	PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus OX=10116 GN=Plcb3 PE=1 SV=2
18	Q9NQ66	1029	1216	0.474	0.462	PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 PE=1 SV=1
19	Q9QW07	702	1175	0.359	0.363	PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus OX=10116 GN=Plcb4 PE=1 SV=2
20	Q9Z1B3	1036	1216	0.475	0.463	PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus OX=10090 GN=Plcb1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.7e-05	36.4	C2 domain
2	PF06631 DUF1154	89	14.4	Protein of unknown function (DUF1154)
3	PF10758 DUF2586	6.3e+02	10.7	Protein of unknown function (DUF2586)
4	PF09279 EF-hand_like	1.4e-06	40.0	Phosphoinositide-specific phospholipase C, efhand-like
5	PF07902 Gp58	5e+02	10.4	gp58-like protein
6	PF17787 PH_14	1.6e-47	172.0	PH domain
7	PF00388 PI-PLC-X	1.3e-56	201.7	Phosphatidylinositol-specific phospholipase C, X domain
8	PF00387 PI-PLC-Y	2.8e-33	126.0	Phosphatidylinositol-specific phospholipase C, Y domain
9	PF08703 PLC-beta_C	1.3e-70	248.3	PLC-beta C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000260402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.995	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000381339	0.980	Guanine nucleotide-binding protein G(t) subunit alpha-3
3	9606.ENSP00000348461	0.970	Ras-related C3 botulinum toxin substrate 1
4	9606.ENSP00000334448	0.963	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
5	9606.ENSP00000481878	0.961	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
6	9606.ENSP00000338345	0.959	Alpha-synuclein
7	9606.ENSP00000261837	0.955	Guanine nucleotide-binding protein subunit beta-5
8	9606.ENSP00000078429	0.951	Guanine nucleotide-binding protein subunit alpha-11
9	9606.ENSP00000262958	0.942	Guanine nucleotide-binding protein subunit alpha-15
10	9606.ENSP00000365807	0.940	Guanine nucleotide-binding protein subunit alpha-14
11	9606.ENSP00000229795	0.933	Mitogen-activated protein kinase 14
12	9606.ENSP00000419325	0.924	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial
13	9606.ENSP00000373399	0.923	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
14	9606.ENSP00000246672	0.922	Nuclear receptor subfamily 1 group D member 1
15	9606.ENSP00000368683	0.920	Endothelin-1
16	9606.ENSP00000262613	0.919	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
17	9606.ENSP00000365757	0.919	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
18	9606.ENSP00000265382	0.918	Phosphatidylinositol 4-phosphate 5-kinase type-1 beta
19	9606.ENSP00000466363	0.916	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
20	9606.ENSP00000357883	0.915	Phosphatidylinositol 4-phosphate 5-kinase type-1 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004435	0.999	phosphatidylinositol phospholipase C activity
GO:0005543	0.359	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0023052	0.995	signaling
GO:0007154	0.995	cell communication
GO:0007165	0.994	signal transduction
GO:0007186	0.944	G protein-coupled receptor signaling pathway
GO:0044237	0.934	cellular metabolic process
GO:0046486	0.884	glycerolipid metabolic process
GO:0050790	0.738	regulation of catalytic activity
GO:0006796	0.737	phosphate-containing compound metabolic process
GO:0019637	0.727	organophosphate metabolic process
GO:0032501	0.725	multicellular organismal process
GO:0006644	0.627	phospholipid metabolic process
GO:0006650	0.594	glycerophospholipid metabolic process
GO:0060191	0.537	regulation of lipase activity
GO:0010517	0.472	regulation of phospholipase activity
GO:0046488	0.443	phosphatidylinositol metabolic process
GO:0042221	0.382	response to chemical
GO:0003008	0.329	system process
GO:0043085	0.305	positive regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.948	membrane
GO:0043227	0.940	membrane-bounded organelle
GO:0071944	0.919	cell periphery
GO:0005886	0.884	plasma membrane
GO:0043229	0.818	intracellular organelle
GO:0012505	0.800	endomembrane system
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0031982	0.547	vesicle
GO:0032991	0.355	protein-containing complex
GO:0031410	0.336	cytoplasmic vesicle
GO:0005634	0.302	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.999	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.999	phosphoinositide phospholipase C.

[back to server]