StarFunc result for job id Q00839

User Input

>input (825 residues)
MSSSPVNVKKLKVSELKEELKKRRLSDKGLKAELMERLQAALDDEEAGGRPAMEPGNGSL
DLGGDSAGRSGAGLEQEAAAGGDEEEEEEEEEEEGISALDGDQMELGEENGAAGAADSGP
MEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQPQPPATQQQQPQQQRGAA
KEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGKKKAEGGGGGGRPGAPAAGDGKTEQKGG
DKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK
ISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVR
IGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFESDEVELS
YAKNGQDLGVAFKISKEVLAGRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEEYTFIQNVP
LEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVA
GFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQ
RKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKE
EAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFR
GGAPGNRGGYNRRGNMPQRGGGGGGSGGIGYPYPRAPVFPGRGSYSNRGNYNRGGMPNRG
NYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1X7SBS1	0.524	0.578	0.000	744	0.901	0.999	A0A1X7SBS1.pdb.gz	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
2	AFDB:Q00839	1.000	1.000	0.000	825	1.000	1.000	Q00839.pdb.gz	HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6
3	AFDB:Q8VEK3	0.605	0.623	0.000	800	0.942	0.971	Q8VEK3.pdb.gz	HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1
4	AFDB:E1JGL8	0.459	0.300	1.115E-50	1272	0.308	0.200	E1JGL8.pdb.gz	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
5	PDB:7nscA	0.186	0.535	7.481E-12	276	0.081	0.243	7nscA.pdb.gz
6	PDB:7ccbA	0.178	0.833	7.705E-10	164	0.042	0.213	7ccbA.pdb.gz
7	AFDB:P53076	0.175	0.152	1.877E-9	958	0.099	0.086	P53076.pdb.gz	VID30_YEAST Vacuolar import and degradation protein 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VID30 PE=1 SV=1
8	PDB:6swy1	0.173	0.258	1.405E-8	542	0.063	0.096	6swy1.pdb.gz
9	PDB:7ua3A	0.156	0.031	3.840E-8	4443	0.046	0.009	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
10	PDB:6wotA	0.155	0.032	4.294E-8	4197	0.041	0.008	6wotA.pdb.gz	Structural mechanism of two gain-of-function cardiac and skeletal RyR mutations at an equivalent site by cryo-EM.
11	PDB:7tzcA	0.139	0.027	7.097E-8	4404	0.042	0.008	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
12	PDB:6venO	0.177	0.447	7.505E-8	315	0.039	0.102	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
13	PDB:7m6aA	0.154	0.031	9.922E-8	4306	0.042	0.008	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
14	PDB:7vmlA	0.150	0.032	4.738E-7	4044	0.041	0.008	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.
15	PDB:7u9tA	0.159	0.032	5.010E-7	4229	0.047	0.009	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
16	AFDB:Q15424	0.057	0.052	2.078E-4	915	0.166	0.150	Q15424.pdb.gz	SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4
17	AFDB:D3YXK2	0.060	0.054	1.173E-3	937	0.184	0.162	D3YXK2.pdb.gz	SAFB1_MOUSE Scaffold attachment factor B1 OS=Mus musculus OX=10090 GN=Safb PE=1 SV=2
18	AFDB:Q8IGV1	0.059	0.053	1.640E-3	977	0.137	0.116	Q8IGV1.pdb.gz	Q8IGV1_DROME RE24907p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Saf-B PE=2 SV=1
19	AFDB:O61643	0.072	0.065	2.867E-3	946	0.067	0.058	O61643.pdb.gz	INHB_DROME Inhibin beta chain OS=Drosophila melanogaster OX=7227 GN=Actbeta PE=1 SV=2
20	AFDB:Q14151	0.055	0.048	6.625E-3	953	0.155	0.134	Q14151.pdb.gz	SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRA5	0.0	543	766	0.316	0.341	A0A0A0MRA5_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
2	A0A1W2PP34	0.0	1082	546	0.628	0.949	A0A1W2PP34_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
3	A0A1W2PP35	0.0	1487	728	0.882	1.000	A0A1W2PP35_HUMAN Heterogeneous nuclear ribonucleoprotein U (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
4	A0A1W2PPH7	0.0	1124	549	0.648	0.974	A0A1W2PPH7_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
5	A0A1W2PPL4	0.0	1116	547	0.646	0.974	A0A1W2PPL4_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
6	A0A1W2PQD4	0.0	664	327	0.395	0.997	A0A1W2PQD4_HUMAN Heterogeneous nuclear ribonucleoprotein U (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
7	A0A1X7SBS1	0.0	1021	744	0.645	0.715	A0A1X7SBS1_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=1
8	B7Z4B8	0.0	543	767	0.316	0.340	B7Z4B8_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
9	M0R3F1	0.0	541	641	0.316	0.407	M0R3F1_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
10	Q00839	0.0	1694	825	1.000	1.000	HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6
11	Q5RI18	0.0	1249	602	0.721	0.988	Q5RI18_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=9
12	Q6IMY8	0.0	1568	798	0.938	0.970	HNRPU_RAT Heterogeneous nuclear ribonucleoprotein U OS=Rattus norvegicus OX=10116 GN=Hnrnpu PE=1 SV=1
13	Q8VDM6	0.0	543	859	0.316	0.304	HNRL1_MOUSE Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Mus musculus OX=10090 GN=Hnrnpul1 PE=1 SV=1
14	Q8VEK3	0.0	1576	800	0.943	0.973	HNRPU_MOUSE Heterogeneous nuclear ribonucleoprotein U OS=Mus musculus OX=10090 GN=Hnrnpu PE=1 SV=1
15	Q9BUJ2	0.0	544	856	0.316	0.305	HNRL1_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2
16	Q9YHD2	2.90e-125	395	757	0.275	0.300	Q9YHD2_CHICK Nuclear calmodulin-binding protein (Fragment) OS=Gallus gallus OX=9031 GN=URP PE=2 SV=1
17	M0QYZ0	3.24e-119	367	371	0.217	0.482	M0QYZ0_HUMAN Heterogeneous nuclear ribonucleoprotein U like 1 (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=1
18	Q86NY3	5.27e-43	169	739	0.105	0.118	Q86NY3_DROME LD24631p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG30122 PE=2 SV=1
19	A8E6M1	3.61e-41	166	1271	0.104	0.068	A8E6M1_DROME GH01011p OS=Drosophila melanogaster OX=7227 GN=CG5477 PE=1 SV=1
20	E1JGL8	3.62e-41	166	1272	0.104	0.068	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13238 AAA_18	1.1e+02	14.8	AAA domain
2	PF13671 AAA_33	2.3e-23	94.4	AAA domain
3	PF02037 SAP	8.8e-07	39.8	SAP domain
4	PF00622 SPRY	1.4e-10	52.7	SPRY domain
5	PF00448 SRP54	1.3e+02	13.7	SRP54-type protein, GTPase domain
6	PF06414 Zeta_toxin	2.8e+02	12.3	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000283179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341826	0.996	Heterogeneous nuclear ribonucleoprotein A1
2	9606.ENSP00000358635	0.996	Heterogeneous nuclear ribonucleoprotein Q
3	9606.ENSP00000349168	0.995	Heterogeneous nuclear ribonucleoprotein H
4	9606.ENSP00000365439	0.994	Heterogeneous nuclear ribonucleoprotein K
5	9606.ENSP00000346694	0.993	Heterogeneous nuclear ribonucleoproteins A2/B1
6	9606.ENSP00000313199	0.992	Heterogeneous nuclear ribonucleoprotein D0
7	9606.ENSP00000325376	0.992	Heterogeneous nuclear ribonucleoprotein M
8	9606.ENSP00000356520	0.991	ATP-dependent RNA helicase A
9	9606.ENSP00000451291	0.991	Heterogeneous nuclear ribonucleoproteins C1/C2
10	9606.ENSP00000221419	0.988	Heterogeneous nuclear ribonucleoprotein L
11	9606.ENSP00000400433	0.988	Heterogeneous nuclear ribonucleoprotein F
12	9606.ENSP00000354346	0.986	Matrin-3
13	9606.ENSP00000316042	0.984	Heterogeneous nuclear ribonucleoprotein A0
14	9606.ENSP00000361626	0.981	Nuclease-sensitive element-binding protein 1
15	9606.ENSP00000349428	0.978	Polypyrimidine tract-binding protein 1
16	9606.ENSP00000363745	0.978	Heterogeneous nuclear ribonucleoprotein R
17	9606.ENSP00000225792	0.974	Probable ATP-dependent RNA helicase DDX5
18	9606.ENSP00000376309	0.967	Heterogeneous nuclear ribonucleoprotein A3
19	9606.ENSP00000290341	0.962	Insulin-like growth factor 2 mRNA-binding protein 1
20	9606.ENSP00000359645	0.953	RNA-binding motif protein, X chromosome

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0003723	0.999	RNA binding
GO:0003677	0.997	DNA binding
GO:0000993	0.997	RNA polymerase II complex binding
GO:0043021	0.995	ribonucleoprotein complex binding
GO:0070717	0.994	poly-purine tract binding
GO:1990837	0.988	sequence-specific double-stranded DNA binding
GO:0034046	0.880	poly(G) binding
GO:1990841	0.788	promoter-specific chromatin binding
GO:0008143	0.684	poly(A) binding
GO:0008134	0.640	transcription factor binding
GO:0140110	0.628	transcription regulator activity
GO:0001091	0.623	RNA polymerase II general transcription initiation factor binding
GO:1901265	0.610	nucleoside phosphate binding
GO:0003712	0.590	transcription coregulator activity
GO:0003729	0.586	mRNA binding
GO:0070034	0.574	telomerase RNA binding
GO:0000166	0.571	nucleotide binding
GO:0017069	0.569	snRNA binding
GO:0003725	0.569	double-stranded RNA binding
GO:0043167	0.565	ion binding
GO:0031490	0.564	chromatin DNA binding
GO:0003714	0.563	transcription corepressor activity
GO:0003697	0.556	single-stranded DNA binding
GO:0008187	0.546	poly-pyrimidine tract binding
GO:0030554	0.528	adenyl nucleotide binding
GO:0005524	0.523	ATP binding
GO:0003779	0.515	actin binding
GO:0017130	0.384	poly(C) RNA binding
GO:0001097	0.370	TFIIH-class transcription factor complex binding
GO:0036002	0.352	pre-mRNA binding
GO:0042802	0.317	identical protein binding
GO:0003730	0.303	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.996	biological regulation
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0050896	0.980	response to stimulus
GO:0043170	0.980	macromolecule metabolic process
GO:0048518	0.973	positive regulation of biological process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0019219	0.971	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.960	regulation of RNA metabolic process
GO:0034641	0.954	cellular nitrogen compound metabolic process
GO:0010556	0.948	regulation of macromolecule biosynthetic process
GO:0010604	0.946	positive regulation of macromolecule metabolic process
GO:1901360	0.945	organic cyclic compound metabolic process
GO:0048522	0.942	positive regulation of cellular process
GO:0090304	0.942	nucleic acid metabolic process
GO:0010468	0.941	regulation of gene expression
GO:0031326	0.941	regulation of cellular biosynthetic process
GO:0016070	0.927	RNA metabolic process
GO:0071840	0.896	cellular component organization or biogenesis
GO:0048523	0.895	negative regulation of cellular process
GO:0051173	0.893	positive regulation of nitrogen compound metabolic process
GO:0031325	0.893	positive regulation of cellular metabolic process
GO:0016043	0.881	cellular component organization
GO:0051179	0.875	localization
GO:0010557	0.864	positive regulation of macromolecule biosynthetic process
GO:0031328	0.862	positive regulation of cellular biosynthetic process
GO:0010628	0.851	positive regulation of gene expression
GO:0045935	0.828	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.822	regulation of DNA-templated transcription
GO:0016071	0.812	mRNA metabolic process
GO:0051716	0.807	cellular response to stimulus
GO:0065009	0.803	regulation of molecular function
GO:0042221	0.739	response to chemical
GO:0010467	0.712	gene expression
GO:0051254	0.646	positive regulation of RNA metabolic process
GO:0010605	0.616	negative regulation of macromolecule metabolic process
GO:0051172	0.585	negative regulation of nitrogen compound metabolic process
GO:0033036	0.561	macromolecule localization
GO:0045934	0.556	negative regulation of nucleobase-containing compound metabolic process
GO:0006396	0.536	RNA processing
GO:0008380	0.522	RNA splicing
GO:0006397	0.520	mRNA processing
GO:0051253	0.503	negative regulation of RNA metabolic process
GO:0071310	0.459	cellular response to organic substance
GO:0032502	0.394	developmental process
GO:0000398	0.366	mRNA splicing, via spliceosome
GO:0045893	0.356	positive regulation of DNA-templated transcription
GO:0006357	0.355	regulation of transcription by RNA polymerase II
GO:0032501	0.354	multicellular organismal process
GO:0051246	0.350	regulation of protein metabolic process
GO:0044260	0.345	cellular macromolecule metabolic process
GO:0050790	0.341	regulation of catalytic activity
GO:1903311	0.320	regulation of mRNA metabolic process
GO:0045944	0.300	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0032991	0.986	protein-containing complex
GO:0043228	0.971	non-membrane-bounded organelle
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:1990904	0.875	ribonucleoprotein complex
GO:0005694	0.470	chromosome
GO:0005737	0.464	cytoplasm
GO:0098577	0.385	inactive sex chromosome
GO:0140513	0.376	nuclear protein-containing complex
GO:0005829	0.356	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]