StarFunc result for job id Q00872

User Input

>input (1141 residues)
MPEPTKKEENEVPAPAPPPEEPSKEKEAGTTPAKDWTLVETPPGEEQAKQNANSQLSILF
IEKPQGGTVKVGEDITFIAKVKAEDLLRKPTIKWFKGKWMDLASKAGKHLQLKETFERHS
RVYTFEMQIIKAKDNFAGNYRCEVTYKDKFDSCSFDLEVHESTGTTPNIDIRSAFKRSGE
GQEDAGELDFSGLLKRREVKQQEEEPQVDVWELLKNAKPSEYEKIAFQYGITDLRGMLKR
LKRMRREEKKSAAFAKILDPAYQVDKGGRVRFVVELADPKLEVKWYKNGQEIRPSTKYIF
EHKGCQRILFINNCQMTDDSEYYVTAGDEKCSTELFVREPPIMVTKQLEDTTAYCGERVE
LECEVSEDDANVKWFKNGEEIIPGPKSRYRIRVEGKKHILIIEGATKADAAEYSVMTTGG
QSSAKLSVDLKPLKILTPLTDQTVNLGKEICLKCEISENIPGKWTKNGLPVQESDRLKVV
HKGRIHKLVIANALTEDEGDYVFAPDAYNVTLPAKVHVIDPPKIILDGLDADNTVTVIAG
NKLRLEIPISGEPPPKAMWSRGDKAIMEGSGRIRTESYPDSSTLVIDIAERDDSGVYHIN
LKNEAGEAHASIKVKVVDFPDPPVAPTVTEVGDDWCIMNWEPPAYDGGSPILGYFIERKK
KQSSRWMRLNFDLCKETTFEPKKMIEGVAYEVRIFAVNAIGISKPSMPSRPFVPLAVTSP
PTLLTVDSVTDTTVTMRWRPPDHIGAAGLDGYVLEYCFEGSTSAKQSDENGEAAYDLPAE
DWIVANKDLIDKTKFTITGLPTDAKIFVRVKAVNAAGASEPKYYSQPILVKEIIEPPKIR
IPRHLKQTYIRRVGEAVNLVIPFQGKPRPELTWKKDGAEIDKNQINIRNSETDTIIFIRK
AERSHSGKYDLQVKVDKFVETASIDIQIIDRPGPPQIVKIEDVWGENVALTWTPPKDDGN
AAITGYTIQKADKKSMEWFTVIEHYHRTSATITELVIGNEYYFRVFSENMCGLSEDATMT
KESAVIARDGKIYKNPVYEDFDFSEAPMFTQPLVNTYAIAGYNATLNCSVRGNPKPKITW
MKNKVAIVDDPRYRMFSNQGVCTLEIRKPSPYDGGTYCCKAVNDLGTVEIECKLEVKVIA
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1L1QZU5	0.279	0.252	0.000	1287	0.541	0.479	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	AFDB:A0A571BEN1	0.408	0.409	0.000	1139	0.893	0.895	A0A571BEN1.pdb.gz	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	AFDB:A5WWB7	0.366	0.364	0.000	1147	0.658	0.655	A5WWB7.pdb.gz
4	AFDB:A6QP89	0.367	0.351	0.000	1198	0.922	0.878	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
5	AFDB:E7EZ79	0.234	0.213	0.000	1266	0.541	0.487	E7EZ79.pdb.gz
6	AFDB:F1R6I7	0.270	0.277	0.000	1111	0.505	0.518	F1R6I7.pdb.gz
7	AFDB:P16419	0.258	0.258	0.000	1132	0.487	0.491	P16419.pdb.gz	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
8	AFDB:P56741	0.366	0.331	0.000	1274	0.500	0.448	P56741.pdb.gz	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
9	AFDB:Q14324	0.254	0.254	0.000	1141	0.493	0.493	Q14324.pdb.gz	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
10	AFDB:Q14896	0.344	0.312	0.000	1274	0.500	0.448	Q14896.pdb.gz	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
11	PDB:5oj2B	0.148	0.227	5.841E-24	692	0.109	0.179	5oj2B.pdb.gz
12	PDB:1e07A	0.130	0.196	1.497E-23	642	0.104	0.185	1e07A.pdb.gz
13	PDB:7sqcO0	0.136	0.136	2.008E-19	1140	0.093	0.093	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.086	0.068	1.461E-16	1597	0.086	0.061	5a42A.pdb.gz
15	PDB:7q1yA	0.103	0.090	3.424E-16	1374	0.074	0.062	7q1yA.pdb.gz
16	PDB:7q5zA	0.116	0.104	5.426E-14	1344	0.071	0.060	7q5zA.pdb.gz
17	PDB:6h03A	0.105	0.102	1.272E-13	1223	0.065	0.061	6h03A.pdb.gz
18	PDB:4lnvA	0.096	0.089	5.838E-13	1276	0.079	0.071	4lnvA.pdb.gz
19	PDB:4ziqA	0.101	0.087	1.497E-12	1450	0.078	0.061	4ziqA.pdb.gz
20	PDB:6dldD	0.137	0.432	1.873E-12	269	0.046	0.197	6dldD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L1QZU5	0.0	1210	1287	0.540	0.479	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
2	A0A571BEN1	0.0	2118	1139	0.894	0.896	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
3	A6QP89	0.0	2144	1198	0.918	0.875	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
4	D3YU50	0.0	2124	1127	0.897	0.908	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
5	F6RQD1	0.0	1200	626	0.506	0.922	F6RQD1_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
6	F7D574	0.0	721	362	0.301	0.950	F7D574_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
7	O70468	0.0	1158	1270	0.503	0.452	MYPC3_MOUSE Myosin-binding protein C, cardiac-type OS=Mus musculus OX=10090 GN=Mybpc3 PE=1 SV=1
8	P16419	0.0	1130	1132	0.479	0.482	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
9	P56741	0.0	1177	1274	0.507	0.454	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2
10	Q00872	0.0	2354	1141	1.000	1.000	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
11	Q14324	0.0	1137	1141	0.501	0.501	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
12	Q14896	0.0	1156	1274	0.495	0.443	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
13	Q5BJ14	0.0	1145	1111	0.507	0.521	Q5BJ14_DANRE Zgc:110761 OS=Danio rerio OX=7955 GN=zgc:110761 PE=2 SV=1
14	Q5U3B1	0.0	1535	1168	0.665	0.650	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
15	Q5XKE0	0.0	1151	1136	0.500	0.502	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
16	Q63518	0.0	1134	621	0.480	0.882	MYPC1_RAT Myosin-binding protein C, slow-type (Fragment) OS=Rattus norvegicus OX=10116 GN=Mybpc1 PE=1 SV=1
17	Q6P6L5	0.0	2125	1124	0.906	0.920	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
18	Q86T42	0.0	1508	783	0.649	0.945	Q86T42_HUMAN Uncharacterized protein DKFZp451E186 OS=Homo sapiens OX=9606 GN=DKFZp451E186 PE=2 SV=1
19	Q90688	0.0	1219	1272	0.528	0.474	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
20	Q13203	5.91e-147	451	477	0.195	0.465	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	0.43	22.3	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	8.7e-05	33.8	CD80-like C2-set immunoglobulin domain
3	PF15418 DUF4625	1.9e+02	13.7	Domain of unknown function (DUF4625)
4	PF00041 fn3	5.9e-38	140.4	Fibronectin type III domain
5	PF07679 I-set	1.7e-92	315.0	Immunoglobulin I-set domain
6	PF00047 ig	5.9e-30	114.6	Immunoglobulin domain
7	PF13895 Ig_2	8.5e-30	114.2	Immunoglobulin domain
8	PF13927 Ig_3	7.9e-60	210.7	Immunoglobulin domain
9	PF16681 Ig_5	0.0051	28.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF16656 Pur_ac_phosph_N	11	18.0	Purple acid Phosphatase, N-terminal domain
11	PF11465 Receptor_2B4	3.8e+02	12.7	Natural killer cell receptor 2B4
12	PF18362 THB	6.1e-18	75.4	Tri-helix bundle domain
13	PF07686 V-set	1.2e-10	52.9	Immunoglobulin V-set domain
14	PF08204 V-set_CD47	4.3	18.8	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400908

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278317	0.914	Troponin T, fast skeletal muscle
2	9606.ENSP00000350332	0.914	Myosin-binding protein C, fast-type
3	9606.ENSP00000371331	0.913	Troponin I, fast skeletal muscle
4	9606.ENSP00000442795	0.903	Myosin-binding protein C, cardiac-type
5	9606.ENSP00000307280	0.870	Myosin light chain 1/3, skeletal muscle isoform
6	9606.ENSP00000361636	0.850	Troponin C, skeletal muscle
7	9606.ENSP00000354488	0.829	Troponin I, slow skeletal muscle
8	9606.ENSP00000467176	0.816	Troponin T, slow skeletal muscle
9	9606.ENSP00000384330	0.809	Myosin-8
10	9606.ENSP00000367542	0.800	Tropomyosin beta chain
11	9606.ENSP00000484342	0.800	Nebulin
12	9606.ENSP00000464317	0.793	Myosin-3
13	9606.ENSP00000379210	0.786	Myosin light chain 3
14	9606.ENSP00000397598	0.775	Kyphoscoliosis peptidase
15	9606.ENSP00000327145	0.771	Filamin-C
16	9606.ENSP00000259365	0.768	Tropomodulin-1
17	9606.ENSP00000236918	0.767	Troponin T, cardiac muscle
18	9606.ENSP00000443495	0.767	Alpha-actinin-2
19	9606.ENSP00000467141	0.763	Titin
20	9606.ENSP00000354923	0.753	Dystrophin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005198	1.000	structural molecule activity
GO:0005515	0.998	protein binding
GO:0008092	0.969	cytoskeletal protein binding
GO:0005200	0.930	structural constituent of cytoskeleton
GO:0008307	0.910	structural constituent of muscle
GO:0017022	0.357	myosin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0006936	0.986	muscle contraction
GO:0065007	0.365	biological regulation
GO:0050789	0.347	regulation of biological process
GO:0048856	0.339	anatomical structure development
GO:0009987	0.300	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005829	0.994	cytosol
GO:0005856	0.979	cytoskeleton
GO:0099080	0.890	supramolecular complex
GO:0099512	0.774	supramolecular fiber
GO:0043227	0.657	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]