StarFunc result for job id Q00978

User Input

>input (393 residues)
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFK
AWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIV
SGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIG
SSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLD
CRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISW
NAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSH
TPQNLITVKMEQAFARYLLEQTPEQQAAILSLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61179	0.495	0.487	6.274E-57	399	0.697	0.687	Q61179.pdb.gz	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
2	AFDB:H0YNP4	0.301	0.439	5.012E-36	267	0.656	0.966	H0YNP4.pdb.gz	H0YNP4_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=2
3	AFDB:H0YMB0	0.405	0.448	5.649E-36	353	0.595	0.663	H0YMB0.pdb.gz	H0YMB0_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=1
4	AFDB:Q15306	0.406	0.356	9.384E-35	451	0.336	0.293	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
5	AFDB:B5X4X0	0.385	0.354	7.606E-34	430	0.349	0.319	B5X4X0.pdb.gz	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1
6	AFDB:A8B8L1	0.387	0.335	9.661E-34	460	0.341	0.291	A8B8L1.pdb.gz
7	AFDB:Q02556	0.375	0.347	8.314E-33	426	0.338	0.312	Q02556.pdb.gz	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
8	AFDB:Q5NUI4	0.382	0.355	6.739E-32	424	0.351	0.325	Q5NUI4.pdb.gz
9	AFDB:Q6DHK7	0.348	0.326	4.428E-30	423	0.331	0.307	Q6DHK7.pdb.gz	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
10	AFDB:G0Z349	0.383	0.326	1.185E-26	467	0.308	0.259	G0Z349.pdb.gz	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
11	PDB:7dvqX	0.206	0.473	4.316E-2	156	0.048	0.122	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:1u0rD	0.152	0.194	7.847E-2	301	0.043	0.056	1u0rD.pdb.gz
13	PDB:2gjeD	0.089	0.161	8.844E-2	147	0.053	0.143	2gjeD.pdb.gz	Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
14	PDB:6z4eA	0.111	0.191	9.968E-2	207	0.023	0.043	6z4eA.pdb.gz
15	PDB:3afoA	0.090	0.097	1.193E-1	360	0.033	0.036	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
16	PDB:2kb3A	0.124	0.307	1.344E-1	143	0.051	0.140	2kb3A.pdb.gz
17	PDB:1suwA	0.072	0.104	2.444E-1	249	0.038	0.060	1suwA.pdb.gz	Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP
18	PDB:2byoA	0.104	0.156	3.498E-1	183	0.053	0.115	2byoA.pdb.gz	Lppx is a Lipoprotein Required for the Translocation of Phthiocerol Dimycocerosates to the Surface of Mycobacterium Tuberculosis.
19	PDB:1u0tB	0.154	0.211	3.714E-1	276	0.053	0.076	1u0tB.pdb.gz
20	PDB:4gojC	0.107	0.194	4.186E-1	161	0.028	0.068	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YNP4	0.0	801	402	1.000	0.978	H0YNP4_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=2
2	Q00978	0.0	810	393	1.000	1.000	IRF9_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=1
3	Q61179	0.0	514	399	0.700	0.689	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
4	H0YMB0	2.26e-161	459	353	0.583	0.649	H0YMB0_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=1
5	A0A8I6AJP7	3.18e-68	224	466	0.338	0.285	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
6	P23611	1.22e-67	222	424	0.338	0.314	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
7	Q02556	1.57e-63	211	426	0.323	0.298	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
8	Q64287	2.75e-62	208	450	0.359	0.313	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
9	B5X4X0	4.88e-62	207	430	0.359	0.328	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1
10	Q6DHK7	2.12e-59	200	423	0.338	0.314	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
11	H3BT31	2.24e-55	187	328	0.280	0.335	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
12	Q15306	7.78e-50	176	451	0.328	0.286	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
13	G0Z349	8.83e-38	144	467	0.310	0.261	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
14	O14896	8.83e-38	144	467	0.310	0.261	IRF6_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
15	P97431	1.71e-37	143	467	0.308	0.259	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
16	Q13568	6.98e-32	128	498	0.303	0.239	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
17	A0A8I5YBA0	3.21e-30	124	536	0.298	0.218	A0A8I5YBA0_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
18	A0A0G2JUR2	5.77e-30	123	528	0.295	0.220	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
19	D3ZPU1	8.26e-30	122	497	0.298	0.235	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
20	F1QNG2	3.12e-26	111	422	0.267	0.249	F1QNG2_DANRE Interferon regulatory factor 7 OS=Danio rerio OX=7955 GN=wu:fl24c03 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	8.2e-35	130.6	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	1.3e-38	144.1	Interferon-regulatory factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315768	0.999	Signal transducer and activator of transcription 2
2	9606.ENSP00000354394	0.999	Signal transducer and activator of transcription 1-alpha/beta
3	9606.ENSP00000381601	0.994	Interferon-induced GTP-binding protein Mx1
4	9606.ENSP00000368699	0.993	Ubiquitin-like protein ISG15
5	9606.ENSP00000343957	0.990	Interferon alpha/beta receptor 2
6	9606.ENSP00000270139	0.989	Interferon alpha/beta receptor 1
7	9606.ENSP00000342513	0.988	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
8	9606.ENSP00000360869	0.987	Interferon-induced protein with tetratricopeptide repeats 1
9	9606.ENSP00000360883	0.987	Interferon-induced protein with tetratricopeptide repeats 3
10	9606.ENSP00000388001	0.984	2'-5'-oligoadenylate synthase 1
11	9606.ENSP00000395590	0.983	Interferon-induced 35 kDa protein
12	9606.ENSP00000342278	0.982	2'-5'-oligoadenylate synthase 2
13	9606.ENSP00000431885	0.978	Non-receptor tyrosine-protein kinase TYK2
14	9606.ENSP00000360891	0.976	Interferon-induced protein with tetratricopeptide repeats 2
15	9606.ENSP00000245414	0.974	Interferon regulatory factor 1
16	9606.ENSP00000354822	0.974	XIAP-associated factor 1
17	9606.ENSP00000369581	0.974	Interferon beta
18	9606.ENSP00000371471	0.974	Radical S-adenosyl methionine domain-containing protein 2
19	9606.ENSP00000380697	0.974	Interferon regulatory factor 7
20	9606.ENSP00000386187	0.973	Interferon-induced transmembrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.996	transcription regulator activity
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0003700	0.994	DNA-binding transcription factor activity
GO:0001067	0.969	transcription regulatory region nucleic acid binding
GO:0000976	0.944	transcription cis-regulatory region binding
GO:0000981	0.879	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.506	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.324	DNA-binding transcription activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0051716	0.985	cellular response to stimulus
GO:0010468	0.985	regulation of gene expression
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0048522	0.980	positive regulation of cellular process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0023052	0.976	signaling
GO:0009893	0.969	positive regulation of metabolic process
GO:0010604	0.955	positive regulation of macromolecule metabolic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.947	regulation of RNA biosynthetic process
GO:0043170	0.945	macromolecule metabolic process
GO:0044238	0.934	primary metabolic process
GO:0007166	0.925	cell surface receptor signaling pathway
GO:0006355	0.915	regulation of DNA-templated transcription
GO:0031325	0.909	positive regulation of cellular metabolic process
GO:0045944	0.904	positive regulation of transcription by RNA polymerase II
GO:0006807	0.888	nitrogen compound metabolic process
GO:0044237	0.868	cellular metabolic process
GO:0034654	0.847	nucleobase-containing compound biosynthetic process
GO:0097659	0.828	nucleic acid-templated transcription
GO:0006950	0.773	response to stress
GO:0009605	0.767	response to external stimulus
GO:0051707	0.745	response to other organism
GO:0006351	0.706	DNA-templated transcription
GO:0042221	0.578	response to chemical
GO:0002376	0.555	immune system process
GO:0010033	0.554	response to organic substance
GO:0006952	0.548	defense response
GO:0009615	0.523	response to virus
GO:0048583	0.518	regulation of response to stimulus
GO:0048519	0.502	negative regulation of biological process
GO:0098542	0.486	defense response to other organism
GO:0034097	0.482	response to cytokine
GO:0051239	0.412	regulation of multicellular organismal process
GO:0070887	0.407	cellular response to chemical stimulus
GO:0045087	0.396	innate immune response
GO:0001817	0.393	regulation of cytokine production
GO:0071345	0.384	cellular response to cytokine stimulus
GO:0001819	0.367	positive regulation of cytokine production
GO:0002682	0.358	regulation of immune system process
GO:0051607	0.343	defense response to virus
GO:0048523	0.332	negative regulation of cellular process
GO:0031347	0.321	regulation of defense response
GO:0032101	0.313	regulation of response to external stimulus
GO:0006366	0.308	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031981	0.978	nuclear lumen
GO:0005654	0.904	nucleoplasm
GO:0032991	0.394	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]