StarFunc result for job id Q00987

User Input

>input (491 residues)
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00987	1.000	1.000	3.956E-82	491	1.000	1.000	Q00987.pdb.gz	MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 OS=Homo sapiens OX=9606 GN=MDM2 PE=1 SV=1
2	AFDB:P23804	0.296	0.297	1.650E-62	489	0.817	0.820	P23804.pdb.gz	MDM2_MOUSE E3 ubiquitin-protein ligase Mdm2 OS=Mus musculus OX=10090 GN=Mdm2 PE=1 SV=3
3	AFDB:O42354	0.236	0.255	1.664E-40	445	0.434	0.479	O42354.pdb.gz	MDM2_DANRE E3 ubiquitin-protein ligase Mdm2 OS=Danio rerio OX=7955 GN=mdm2 PE=1 SV=1
4	AFDB:O35618	0.293	0.294	6.801E-29	489	0.310	0.311	O35618.pdb.gz	MDM4_MOUSE Protein Mdm4 OS=Mus musculus OX=10090 GN=Mdm4 PE=1 SV=2
5	PDB:7vdvY	0.143	0.281	1.844E-4	245	0.047	0.094	7vdvY.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
6	PDB:6v8oM	0.142	0.216	5.814E-4	310	0.033	0.052	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
7	PDB:6k15I	0.147	0.284	1.033E-3	244	0.029	0.057	6k15I.pdb.gz	Structure of the RSC complex bound to the nucleosome.
8	PDB:6tdaO	0.133	0.293	2.072E-2	212	0.024	0.057	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
9	PDB:5oa30	0.151	0.154	2.674E-2	479	0.033	0.033	5oa30.pdb.gz	Structural and Functional Insights into Human Re-initiation Complexes.
10	PDB:6uxvH	0.119	0.209	8.990E-2	257	0.029	0.054	6uxvH.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:7egmH	0.149	0.185	8.990E-2	388	0.035	0.044	7egmH.pdb.gz
12	AFDB:Q14241	0.069	0.047	1.185E-1	798	0.134	0.083	Q14241.pdb.gz	ELOA1_HUMAN Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2
13	PDB:5gm6a	0.092	0.314	4.724E-1	123	0.024	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	AFDB:Q6SJR1	0.106	0.081	4.824E-1	720	0.122	0.083	Q6SJR1.pdb.gz	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1
15	PDB:7oniR	0.073	0.251	6.927E-1	86	0.037	0.209	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:5dkaA	0.087	0.347	8.941E-1	96	0.029	0.146	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	AFDB:Q9P6R7	0.092	0.070	1.728	713	0.159	0.109	Q9P6R7.pdb.gz	VTS1_SCHPO RNA-binding protein vts1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13E7.03c PE=1 SV=1
18	AFDB:P54253	0.058	0.041	2.535	815	0.116	0.070	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
19	AFDB:Q9U1H0	0.080	0.031	2.535	1832	0.149	0.040	Q9U1H0.pdb.gz	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
20	AFDB:Q63187	0.079	0.054	2.702	773	0.110	0.070	Q63187.pdb.gz	ELOA1_RAT Elongin-A OS=Rattus norvegicus OX=10116 GN=Eloa PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVC1	0.0	692	434	0.739	0.836	A0A0G2JVC1_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=1 SV=2
2	A0A8I6G5V3	0.0	710	477	0.758	0.780	A0A8I6G5V3_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=3 SV=1
3	A0A8I6GK47	0.0	711	468	0.794	0.833	A0A8I6GK47_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=3 SV=1
4	A7UKY0	0.0	523	257	0.523	1.000	A7UKY0_HUMAN Mdm2 (Fragment) OS=Homo sapiens OX=9606 GN=mdm2 PE=1 SV=1
5	D3ZVH5	0.0	720	458	0.780	0.836	D3ZVH5_RAT E3 ubiquitin-protein ligase Mdm2 OS=Rattus norvegicus OX=10116 GN=Mdm2 PE=1 SV=1
6	P23804	0.0	711	489	0.811	0.814	MDM2_MOUSE E3 ubiquitin-protein ligase Mdm2 OS=Mus musculus OX=10090 GN=Mdm2 PE=1 SV=3
7	Q00987	0.0	1008	491	1.000	1.000	MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 OS=Homo sapiens OX=9606 GN=MDM2 PE=1 SV=1
8	O42354	1.03e-110	337	445	0.434	0.479	MDM2_DANRE E3 ubiquitin-protein ligase Mdm2 OS=Danio rerio OX=7955 GN=mdm2 PE=1 SV=1
9	O15151	4.58e-62	212	490	0.320	0.320	MDM4_HUMAN Protein Mdm4 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=2
10	O35618	1.23e-59	206	489	0.338	0.339	MDM4_MOUSE Protein Mdm4 OS=Mus musculus OX=10090 GN=Mdm4 PE=1 SV=2
11	A0A087WZ58	2.43e-38	146	392	0.189	0.237	A0A087WZ58_HUMAN MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
12	A0A087WTR9	2.07e-33	129	267	0.138	0.255	A0A087WTR9_HUMAN MDM4 regulator of p53 OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
13	Q5T0Y3	1.21e-08	56.6	171	0.059	0.170	Q5T0Y3_HUMAN MDM4 regulator of p53 (Fragment) OS=Homo sapiens OX=9606 GN=MDM4 PE=1 SV=1
14	Q9LYW5	3.87e-04	45.1	337	0.037	0.053	LUL1_ARATH Probable E3 ubiquitin-protein ligase LUL1 OS=Arabidopsis thaliana OX=3702 GN=LUL1 PE=1 SV=1
15	Q84ME1	7.39e-04	44.3	378	0.041	0.053	LUL3_ARATH Probable E3 ubiquitin-protein ligase LUL3 OS=Arabidopsis thaliana OX=3702 GN=LUL3 PE=1 SV=1
16	Q8LA32	0.001	43.5	359	0.039	0.053	LUL4_ARATH Probable E3 ubiquitin-protein ligase LUL4 OS=Arabidopsis thaliana OX=3702 GN=LUL4 PE=2 SV=1
17	F4ISV9	0.002	43.1	399	0.035	0.043	APD4_ARATH E3 ubiquitin-protein ligase APD4 OS=Arabidopsis thaliana OX=3702 GN=APD4 PE=2 SV=1
18	Q4FE47	0.002	43.1	462	0.039	0.041	XB35_ARATH Putative E3 ubiquitin-protein ligase XBAT35 OS=Arabidopsis thaliana OX=3702 GN=XBAT35 PE=2 SV=1
19	Q9S752	0.002	43.1	388	0.035	0.044	LOFG2_ARATH Probable E3 ubiquitin-protein ligase LOG2 OS=Arabidopsis thaliana OX=3702 GN=LOG2 PE=1 SV=1
20	Q9LFH6	0.003	42.0	299	0.035	0.057	LUL2_ARATH Probable E3 ubiquitin-protein ligase LUL2 OS=Arabidopsis thaliana OX=3702 GN=LUL2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02201 SWIB	9e-06	36.8	SWIB/MDM2 domain
2	PF13920 zf-C3HC4_3	6.1e-10	50.1	Zinc finger, C3HC4 type (RING finger)
3	PF06827 zf-FPG_IleRS	3.8e+02	12.3	Zinc finger found in FPG and IleRS
4	PF00641 zf-RanBP	9.7e-06	36.1	Zn-finger in Ran binding protein and others
5	PF13639 zf-RING_2	55	15.5	Ring finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000343535	0.999	Ubiquitin carboxyl-terminal hydrolase 7
4	9606.ENSP00000356150	0.999	Protein Mdm4
5	9606.ENSP00000359345	0.999	60S ribosomal protein L5
6	9606.ENSP00000363019	0.999	Ubiquitin-conjugating enzyme E2 D1
7	9606.ENSP00000363668	0.999	Death domain-associated protein 6
8	9606.ENSP00000363676	0.999	60S ribosomal protein L11
9	9606.ENSP00000367545	0.999	Tumor protein p73
10	9606.ENSP00000418915	0.999	Cyclin-dependent kinase inhibitor 2A
11	9606.ENSP00000437955	0.999	Hypoxia-inducible factor 1-alpha
12	9606.ENSP00000267163	0.998	Retinoblastoma-associated protein
13	9606.ENSP00000272317	0.998	Ubiquitin-40S ribosomal protein S27a
14	9606.ENSP00000340330	0.998	Histone acetyltransferase KAT5
15	9606.ENSP00000363822	0.998	Androgen receptor
16	9606.ENSP00000451300	0.998	Protein numb homolog
17	9606.ENSP00000451828	0.998	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000262367	0.997	CREB-binding protein
19	9606.ENSP00000372023	0.997	Serine/threonine-protein kinase Chk2
20	9606.ENSP00000385824	0.997	Forkhead box protein O3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	0.997	p53 binding
GO:0004842	0.997	ubiquitin-protein transferase activity
GO:0061630	0.993	ubiquitin protein ligase activity
GO:1901363	0.986	heterocyclic compound binding
GO:0097159	0.986	organic cyclic compound binding
GO:0003676	0.984	nucleic acid binding
GO:0008270	0.958	zinc ion binding
GO:0019899	0.954	enzyme binding
GO:0032182	0.829	ubiquitin-like protein binding
GO:0044389	0.805	ubiquitin-like protein ligase binding
GO:0031625	0.802	ubiquitin protein ligase binding
GO:0043130	0.725	ubiquitin binding
GO:0042802	0.651	identical protein binding
GO:0003723	0.573	RNA binding
GO:0061663	0.573	NEDD8 ligase activity
GO:0019789	0.555	SUMO transferase activity
GO:0008097	0.551	5S rRNA binding
GO:0097718	0.548	disordered domain specific binding
GO:0043021	0.521	ribonucleoprotein complex binding
GO:0016874	0.443	ligase activity
GO:0033612	0.375	receptor serine/threonine kinase binding
GO:0042975	0.342	peroxisome proliferator activated receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0071704	0.991	organic substance metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0044238	0.986	primary metabolic process
GO:0048518	0.986	positive regulation of biological process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0043170	0.984	macromolecule metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0048523	0.983	negative regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0048522	0.972	positive regulation of cellular process
GO:0009411	0.970	response to UV
GO:0019538	0.970	protein metabolic process
GO:0051172	0.967	negative regulation of nitrogen compound metabolic process
GO:0071482	0.967	cellular response to light stimulus
GO:0009893	0.965	positive regulation of metabolic process
GO:0036211	0.964	protein modification process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0034644	0.959	cellular response to UV
GO:0070887	0.957	cellular response to chemical stimulus
GO:0065009	0.952	regulation of molecular function
GO:0007154	0.938	cell communication
GO:0006950	0.938	response to stress
GO:0046822	0.936	regulation of nucleocytoplasmic transport
GO:0032388	0.936	positive regulation of intracellular transport
GO:0016567	0.935	protein ubiquitination
GO:0030162	0.932	regulation of proteolysis
GO:0031326	0.931	regulation of cellular biosynthetic process
GO:0050790	0.930	regulation of catalytic activity
GO:0010468	0.930	regulation of gene expression
GO:0010556	0.930	regulation of macromolecule biosynthetic process
GO:0010605	0.930	negative regulation of macromolecule metabolic process
GO:0046677	0.926	response to antibiotic
GO:0051252	0.926	regulation of RNA metabolic process
GO:0046824	0.923	positive regulation of nucleocytoplasmic transport
GO:0071236	0.922	cellular response to antibiotic
GO:0010225	0.921	response to UV-C
GO:0033554	0.920	cellular response to stress
GO:0032501	0.919	multicellular organismal process
GO:0006355	0.918	regulation of DNA-templated transcription
GO:0031324	0.908	negative regulation of cellular metabolic process
GO:0051248	0.907	negative regulation of protein metabolic process
GO:0042127	0.899	regulation of cell population proliferation
GO:0043066	0.898	negative regulation of apoptotic process
GO:0044092	0.897	negative regulation of molecular function
GO:0051128	0.897	regulation of cellular component organization
GO:0009719	0.889	response to endogenous stimulus
GO:0045934	0.878	negative regulation of nucleobase-containing compound metabolic process
GO:0071495	0.877	cellular response to endogenous stimulus
GO:0010033	0.871	response to organic substance
GO:0033157	0.856	regulation of intracellular protein transport
GO:0048660	0.854	regulation of smooth muscle cell proliferation
GO:0090316	0.854	positive regulation of intracellular protein transport
GO:1901701	0.841	cellular response to oxygen-containing compound
GO:1903507	0.838	negative regulation of nucleic acid-templated transcription
GO:2000116	0.837	regulation of cysteine-type endopeptidase activity
GO:0043086	0.836	negative regulation of catalytic activity
GO:0045861	0.836	negative regulation of proteolysis
GO:0051173	0.826	positive regulation of nitrogen compound metabolic process
GO:0043281	0.826	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045892	0.824	negative regulation of DNA-templated transcription
GO:0044237	0.820	cellular metabolic process
GO:0010951	0.812	negative regulation of endopeptidase activity
GO:0009605	0.795	response to external stimulus
GO:0071310	0.789	cellular response to organic substance
GO:0008284	0.785	positive regulation of cell population proliferation
GO:2000117	0.783	negative regulation of cysteine-type endopeptidase activity
GO:0043154	0.764	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1901653	0.740	cellular response to peptide
GO:0048583	0.697	regulation of response to stimulus
GO:0007165	0.693	signal transduction
GO:0031325	0.676	positive regulation of cellular metabolic process
GO:0009966	0.650	regulation of signal transduction
GO:0071840	0.613	cellular component organization or biogenesis
GO:0016043	0.528	cellular component organization
GO:0009056	0.514	catabolic process
GO:1901565	0.480	organonitrogen compound catabolic process
GO:0051726	0.427	regulation of cell cycle
GO:0051247	0.414	positive regulation of protein metabolic process
GO:1902531	0.408	regulation of intracellular signal transduction
GO:0035556	0.387	intracellular signal transduction
GO:0006357	0.378	regulation of transcription by RNA polymerase II
GO:0044260	0.340	cellular macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031981	0.997	nuclear lumen
GO:0016020	0.996	membrane
GO:0005886	0.992	plasma membrane
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0005654	0.981	nucleoplasm
GO:0032991	0.952	protein-containing complex
GO:0005730	0.743	nucleolus
GO:0031982	0.546	vesicle
GO:0030054	0.498	cell junction
GO:0005667	0.350	transcription regulator complex
GO:0016604	0.350	nuclear body
GO:0012505	0.324	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.997	Transferases.
EC:6.-.-.-	0.443	Ligases.

[back to server]