StarFunc result for job id Q00994

User Input

>input (111 residues)
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGM
GGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00994	1.000	1.000	1.339E-17	111	1.000	1.000	Q00994.pdb.gz	BEX3_HUMAN Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3 PE=1 SV=1
2	AFDB:Q6PDU5	0.387	0.335	1.229E-13	130	0.937	0.800	Q6PDU5.pdb.gz	BEX3_RAT Protein BEX3 OS=Rattus norvegicus OX=10116 GN=Bex3 PE=2 SV=1
3	AFDB:Q9NWD9	0.341	0.322	8.259E-6	120	0.532	0.492	Q9NWD9.pdb.gz	BEX4_HUMAN Protein BEX4 OS=Homo sapiens OX=9606 GN=BEX4 PE=1 SV=1
4	AFDB:Q3MKQ1	0.332	0.291	4.761E-3	129	0.396	0.341	Q3MKQ1.pdb.gz	BEX2_RAT Protein BEX2 OS=Rattus norvegicus OX=10116 GN=Bex2 PE=1 SV=1
5	AFDB:Q9R224	0.352	0.322	5.529E-3	128	0.369	0.320	Q9R224.pdb.gz	BEX1_MOUSE Protein BEX1 OS=Mus musculus OX=10090 GN=Bex1 PE=1 SV=2
6	AFDB:Q9BXY8	0.328	0.290	9.333E-3	128	0.360	0.312	Q9BXY8.pdb.gz	BEX2_HUMAN Protein BEX2 OS=Homo sapiens OX=9606 GN=BEX2 PE=1 SV=1
7	AFDB:Q3TZW7	0.300	0.293	4.488E-2	114	0.270	0.263	Q3TZW7.pdb.gz	BEX6_MOUSE Protein BEX6 OS=Mus musculus OX=10090 GN=Bex6 PE=3 SV=1
8	AFDB:Q8IYN2	0.368	0.350	4.560E-1	117	0.252	0.239	Q8IYN2.pdb.gz	TCAL8_HUMAN Transcription elongation factor A protein-like 8 OS=Homo sapiens OX=9606 GN=TCEAL8 PE=1 SV=1
9	AFDB:P41818	0.246	0.129	9.633E-1	229	0.126	0.061	P41818.pdb.gz	GLC8_YEAST Protein GLC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLC8 PE=1 SV=1
10	AFDB:A4D998	0.351	0.191	2.193	223	0.117	0.058	A4D998.pdb.gz	BH075_ARATH Transcription factor bHLH75 OS=Arabidopsis thaliana OX=3702 GN=BHLH75 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q00994	5.86e-77	224	111	1.000	1.000	BEX3_HUMAN Protein BEX3 OS=Homo sapiens OX=9606 GN=BEX3 PE=1 SV=1
2	Q9WTZ9	1.29e-52	162	124	0.928	0.831	BEX3_MOUSE Protein BEX3 OS=Mus musculus OX=10090 GN=Bex3 PE=1 SV=1
3	Q6PDU5	1.06e-51	160	130	0.937	0.800	BEX3_RAT Protein BEX3 OS=Rattus norvegicus OX=10116 GN=Bex3 PE=2 SV=1
4	Q5H9J7	3.04e-26	95.9	111	0.550	0.550	BEX5_HUMAN Protein BEX5 OS=Homo sapiens OX=9606 GN=BEX5 PE=1 SV=1
5	Q9NWD9	5.38e-21	82.8	120	0.550	0.508	BEX4_HUMAN Protein BEX4 OS=Homo sapiens OX=9606 GN=BEX4 PE=1 SV=1
6	Q9CWT2	1.46e-15	68.9	118	0.360	0.339	BEX4_MOUSE Protein BEX4 OS=Mus musculus OX=10090 GN=Bex4 PE=1 SV=1
7	Q3MKP9	6.32e-14	64.7	118	0.306	0.288	BEX4_RAT Protein BEX4 OS=Rattus norvegicus OX=10116 GN=Bex4 PE=3 SV=1
8	Q9HBH7	2.09e-11	58.2	125	0.432	0.384	BEX1_HUMAN Protein BEX1 OS=Homo sapiens OX=9606 GN=BEX1 PE=1 SV=2
9	Q9BXY8	1.28e-08	51.2	128	0.261	0.227	BEX2_HUMAN Protein BEX2 OS=Homo sapiens OX=9606 GN=BEX2 PE=1 SV=1
10	Q3MKQ1	6.25e-08	49.3	129	0.243	0.209	BEX2_RAT Protein BEX2 OS=Rattus norvegicus OX=10116 GN=Bex2 PE=1 SV=1
11	Q3MKQ2	7.12e-08	49.3	128	0.243	0.211	BEX1_RAT Protein BEX1 OS=Rattus norvegicus OX=10116 GN=Bex1 PE=1 SV=2
12	Q9WTZ8	9.21e-07	46.2	129	0.225	0.194	BEX2_MOUSE Protein BEX2 OS=Mus musculus OX=10090 GN=Bex2 PE=1 SV=1
13	Q9R224	3.10e-06	45.1	128	0.225	0.195	BEX1_MOUSE Protein BEX1 OS=Mus musculus OX=10090 GN=Bex1 PE=1 SV=2
14	Q3TZW7	6.45e-05	41.2	114	0.216	0.211	BEX6_MOUSE Protein BEX6 OS=Mus musculus OX=10090 GN=Bex6 PE=3 SV=1
15	Q9BRU2	4.63e-04	38.5	100	0.234	0.260	TCAL7_HUMAN Transcription elongation factor A protein-like 7 OS=Homo sapiens OX=9606 GN=TCEAL7 PE=2 SV=2
16	Q9VKY3	0.29	32.0	253	0.135	0.059	Q9VKY3_DROME ATP-dependent Clp protease proteolytic subunit OS=Drosophila melanogaster OX=7227 GN=ClpP PE=1 SV=1
17	Q03611	4.0	28.9	733	0.126	0.019	CNG_CAEEL Cyclic nucleotide-gated cation channel OS=Caenorhabditis elegans OX=6239 GN=tax-4 PE=1 SV=3
18	Q8BZF8	4.4	28.9	567	0.135	0.026	PGM5_MOUSE Phosphoglucomutase-like protein 5 OS=Mus musculus OX=10090 GN=Pgm5 PE=1 SV=2
19	P07663	4.7	28.9	1224	0.135	0.012	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
20	P91200	4.7	28.5	355	0.144	0.045	FUTB1_CAEEL Galactoside 2-alpha-L-fucosyltransferase OS=Caenorhabditis elegans OX=6239 GN=fut-2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04538 BEX	5.5e-21	86.8	Brain expressed X-linked like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022442

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000849	0.963	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
2	61853.ENSNLEP00000003725	0.900	Nerve growth factor receptor
3	61853.ENSNLEP00000015722	0.748	Tuberous sclerosis 1
4	61853.ENSNLEP00000003330	0.708	Sortilin 1
5	61853.ENSNLEP00000003849	0.704	Caspase 2, apoptosis-related cysteine peptidase
6	61853.ENSNLEP00000009213	0.697	G protein-coupled receptor associated sorting protein 1
7	61853.ENSNLEP00000001778	0.689	Diablo, IAP-binding mitochondrial protein
8	61853.ENSNLEP00000006026	0.680	Nerve growth factor (beta polypeptide)
9	61853.ENSNLEP00000009235	0.643	Transcription elongation factor A (SII)-like 7
10	61853.ENSNLEP00000003935	0.623	Uncharacterized protein
11	61853.ENSNLEP00000009964	0.583	MAGE family member D1
12	61853.ENSNLEP00000016407	0.576	Transcription elongation factor A (SII)-like 1
13	61853.ENSNLEP00000004535	0.568	Lysosomal protein transmembrane 4 beta
14	61853.ENSNLEP00000009230	0.567	Transcription elongation factor A (SII)-like 8
15	61853.ENSNLEP00000018817	0.559	NYN domain and retroviral integrase containing
16	61853.ENSNLEP00000009237	0.552	Transcription elongation factor A like 9
17	61853.ENSNLEP00000008089	0.525	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
18	61853.ENSNLEP00000009211	0.512	G protein-coupled receptor associated sorting protein 2
19	61853.ENSNLEP00000009033	0.503	Sortilin-related receptor, L(DLR class) A repeats containing
20	61853.ENSNLEP00000014390	0.503	Sortilin-related VPS10 domain containing receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0098772	0.928	molecular function regulator activity
GO:0042802	0.919	identical protein binding
GO:0043028	0.916	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0016504	0.916	peptidase activator activity
GO:0016505	0.913	peptidase activator activity involved in apoptotic process
GO:0008656	0.897	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0005126	0.316	cytokine receptor binding
GO:0032813	0.314	tumor necrosis factor receptor superfamily binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.975	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0043085	0.959	positive regulation of catalytic activity
GO:0051336	0.950	regulation of hydrolase activity
GO:0051247	0.946	positive regulation of protein metabolic process
GO:0051345	0.906	positive regulation of hydrolase activity
GO:0030162	0.882	regulation of proteolysis
GO:0009987	0.879	cellular process
GO:0010950	0.823	positive regulation of endopeptidase activity
GO:2000116	0.816	regulation of cysteine-type endopeptidase activity
GO:0043280	0.792	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0006919	0.712	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050896	0.568	response to stimulus
GO:0048522	0.509	positive regulation of cellular process
GO:0031323	0.489	regulation of cellular metabolic process
GO:0048519	0.464	negative regulation of biological process
GO:0051716	0.379	cellular response to stimulus
GO:0007154	0.342	cell communication
GO:0023052	0.341	signaling
GO:0007165	0.333	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.853	intracellular membrane-bounded organelle
GO:0005634	0.463	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]