StarFunc result for job id Q00G26

User Input

>input (463 residues)
MSEEEAAQIPRSSVWEQDQQNVVQRVVALPLVRATCTAVCDVYSAAKDRHPLLGSACRLA
ENCVCGLTTRALDHAQPLLEHLQPQLATMNSLACRGLDKLEEKLPFLQQPSETVVTSAKD
VVASSVTGVVDLARRGRRWSVELKRSVSHAVDVVLEKSEELVDHFLPMTEEELAALAAEA
EGPEVGSVEDQRRQQGYFVRLGSLSARIRHLAYEHSVGKLRQSKHRAQDTLAQLQETLEL
IDHMQCGVTPTAPACPGKVHELWGEWGQRPPESRRRSQAELETLVLSRSLTQELQGTVEA
LESSVRGLPAGAQEKVAEVRRSVDALQTAFADARCFRDVPAAALAEGRGRVAHAHACVDE
LLELVVQAVPLPWLVGPFAPILVERPEPLPDLADLVDEVIGGPDPRWAHLDWPAQQRAWE
AEHRDGSGNGDGDRMGVAGDICEQEPETPSCPVKHTLMPELDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00G26	1.000	1.000	8.264E-66	463	1.000	1.000	Q00G26.pdb.gz	PLIN5_HUMAN Perilipin-5 OS=Homo sapiens OX=9606 GN=PLIN5 PE=1 SV=2
2	AFDB:M0R7Z9	0.499	0.488	3.646E-41	475	0.700	0.682	M0R7Z9.pdb.gz	PLIN5_RAT Perilipin-5 OS=Rattus norvegicus OX=10116 GN=Plin5 PE=1 SV=1
3	AFDB:O60664	0.413	0.438	3.545E-22	434	0.350	0.373	O60664.pdb.gz	PLIN3_HUMAN Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3
4	AFDB:Q9DBG5	0.400	0.422	1.062E-20	437	0.324	0.343	Q9DBG5.pdb.gz	PLIN3_MOUSE Perilipin-3 OS=Mus musculus OX=10090 GN=Plin3 PE=1 SV=1
5	AFDB:M0RA08	0.410	0.432	1.887E-20	438	0.330	0.349	M0RA08.pdb.gz	M0RA08_RAT TIR domain-containing adapter molecule 1 OS=Rattus norvegicus OX=10116 GN=Ticam1 PE=4 SV=2
6	AFDB:D0G0B6	0.365	0.368	2.276E-19	459	0.298	0.301	D0G0B6.pdb.gz	D0G0B6_PIG Perilipin OS=Sus scrofa OX=9823 GN=PLIN2 PE=1 SV=1
7	AFDB:Q6FHZ7	0.342	0.361	1.276E-18	437	0.302	0.320	Q6FHZ7.pdb.gz	Q6FHZ7_HUMAN Perilipin OS=Homo sapiens OX=9606 GN=ADFP PE=2 SV=1
8	AFDB:Q5U2U5	0.346	0.378	6.820E-18	422	0.292	0.320	Q5U2U5.pdb.gz	Q5U2U5_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
9	AFDB:P43883	0.325	0.351	5.609E-17	425	0.279	0.304	P43883.pdb.gz	PLIN2_MOUSE Perilipin-2 OS=Mus musculus OX=10090 GN=Plin2 PE=1 SV=2
10	AFDB:Q96Q06	0.355	0.133	3.058E-9	1357	0.171	0.058	Q96Q06.pdb.gz	PLIN4_HUMAN Perilipin-4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=3
11	PDB:4q25A	0.123	0.230	5.494E-1	211	0.063	0.137	4q25A.pdb.gz
12	PDB:2ymnC	0.090	0.097	5.763E-1	409	0.063	0.071	2ymnC.pdb.gz
13	PDB:6ylgb	0.142	0.114	6.343E-1	613	0.037	0.028	6ylgb.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
14	PDB:3szrA	0.117	0.101	7.682E-1	559	0.060	0.050	3szrA.pdb.gz
15	PDB:3geiC	0.182	0.258	9.303E-1	298	0.048	0.074	3geiC.pdb.gz
16	PDB:5nx7A	0.105	0.145	9.760E-1	308	0.067	0.101	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.
17	PDB:6pyzA	0.101	0.125	1.024	353	0.067	0.088	6pyzA.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.
18	PDB:7jgsC	0.097	0.078	1.024	614	0.106	0.080	7jgsC.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
19	PDB:7yqcA	0.113	0.199	1.240	198	0.058	0.136	7yqcA.pdb.gz
20	PDB:7wz4R	0.140	0.220	1.432	233	0.065	0.129	7wz4R.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0R7Z9	0.0	615	475	0.702	0.684	PLIN5_RAT Perilipin-5 OS=Rattus norvegicus OX=10116 GN=Plin5 PE=1 SV=1
2	Q00G26	0.0	929	463	1.000	1.000	PLIN5_HUMAN Perilipin-5 OS=Homo sapiens OX=9606 GN=PLIN5 PE=1 SV=2
3	Q8BVZ1	0.0	617	463	0.711	0.711	PLIN5_MOUSE Perilipin-5 OS=Mus musculus OX=10090 GN=Plin5 PE=1 SV=1
4	O60664	6.68e-88	277	434	0.352	0.376	PLIN3_HUMAN Perilipin-3 OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=3
5	A0A140VJN8	8.14e-88	276	433	0.348	0.372	A0A140VJN8_HUMAN Perilipin OS=Homo sapiens OX=9606 PE=2 SV=1
6	Q9DBG5	5.09e-87	275	437	0.343	0.364	PLIN3_MOUSE Perilipin-3 OS=Mus musculus OX=10090 GN=Plin3 PE=1 SV=1
7	Q9MZE5	4.02e-70	231	459	0.309	0.312	Q9MZE5_PIG Perilipin OS=Sus scrofa OX=9823 GN=ADRP PE=2 SV=2
8	G5DC08	2.33e-68	227	459	0.307	0.309	G5DC08_PIG Perilipin OS=Sus scrofa OX=9823 PE=2 SV=1
9	D0G0B6	4.17e-68	226	459	0.307	0.309	D0G0B6_PIG Perilipin OS=Sus scrofa OX=9823 GN=PLIN2 PE=1 SV=1
10	R9WDQ0	4.44e-68	226	459	0.324	0.327	R9WDQ0_PIG Perilipin OS=Sus scrofa OX=9823 GN=PLIN2 PE=2 SV=1
11	Q6FHZ7	5.61e-68	225	437	0.302	0.320	Q6FHZ7_HUMAN Perilipin OS=Homo sapiens OX=9606 GN=ADFP PE=2 SV=1
12	Q99541	5.61e-68	225	437	0.302	0.320	PLIN2_HUMAN Perilipin-2 OS=Homo sapiens OX=9606 GN=PLIN2 PE=1 SV=2
13	Q4PLW0	5.91e-68	226	459	0.305	0.307	PLIN2_PIG Perilipin-2 OS=Sus scrofa OX=9823 GN=PLIN2 PE=2 SV=1
14	Q5U2U5	1.10e-67	224	422	0.292	0.320	Q5U2U5_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
15	A0A8I5ZQJ5	7.45e-64	214	421	0.289	0.318	A0A8I5ZQJ5_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
16	F6QBA3	1.74e-63	213	405	0.279	0.319	F6QBA3_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=2
17	P43883	1.62e-60	205	425	0.285	0.311	PLIN2_MOUSE Perilipin-2 OS=Mus musculus OX=10090 GN=Plin2 PE=1 SV=2
18	A0A8I6AJS7	1.08e-47	171	399	0.231	0.268	A0A8I6AJS7_RAT Perilipin OS=Rattus norvegicus OX=10116 GN=Plin2 PE=1 SV=1
19	K7ERZ3	8.28e-42	152	292	0.222	0.353	K7ERZ3_HUMAN Perilipin 3 (Fragment) OS=Homo sapiens OX=9606 GN=PLIN3 PE=1 SV=1
20	A0A0J9YXN7	5.51e-22	102	1372	0.184	0.062	A0A0J9YXN7_HUMAN Perilipin 4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04799 Fzo_mitofusin	56	14.6	fzo-like conserved region
2	PF03036 Perilipin	4.8e-128	439.3	Perilipin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337701	0.993	Patatin-like phospholipase domain-containing protein 2
2	9606.ENSP00000390849	0.989	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
3	9606.ENSP00000264867	0.825	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000244289	0.797	Hormone-sensitive lipase
5	9606.ENSP00000320209	0.713	Cell death activator CIDE-A
6	9606.ENSP00000373328	0.694	Cell death activator CIDE-3
7	9606.ENSP00000385523	0.624	Peroxisome proliferator-activated receptor alpha
8	9606.ENSP00000216180	0.617	Patatin-like phospholipase domain-containing protein 3
9	9606.ENSP00000287820	0.609	Peroxisome proliferator-activated receptor gamma
10	9606.ENSP00000382507	0.608	UBX domain-containing protein 2B
11	9606.ENSP00000482264	0.604	Diacylglycerol O-acyltransferase 1
12	9606.ENSP00000228027	0.577	Diacylglycerol O-acyltransferase 2
13	9606.ENSP00000337731	0.514	Cell death activator CIDE-B
14	9606.ENSP00000312455	0.508	CASP8 and FADD-like apoptosis regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.484	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050994	0.995	regulation of lipid catabolic process
GO:0062013	0.987	positive regulation of small molecule metabolic process
GO:0010883	0.986	regulation of lipid storage
GO:0010565	0.984	regulation of cellular ketone metabolic process
GO:0009987	0.971	cellular process
GO:0045834	0.958	positive regulation of lipid metabolic process
GO:0050996	0.948	positive regulation of lipid catabolic process
GO:1905952	0.946	regulation of lipid localization
GO:0019217	0.944	regulation of fatty acid metabolic process
GO:1905954	0.938	positive regulation of lipid localization
GO:0046320	0.928	regulation of fatty acid oxidation
GO:0045923	0.928	positive regulation of fatty acid metabolic process
GO:0031329	0.906	regulation of cellular catabolic process
GO:0010884	0.881	positive regulation of lipid storage
GO:0071840	0.848	cellular component organization or biogenesis
GO:0016043	0.842	cellular component organization
GO:0065009	0.814	regulation of molecular function
GO:0031331	0.787	positive regulation of cellular catabolic process
GO:0060191	0.661	regulation of lipase activity
GO:0008152	0.632	metabolic process
GO:0048519	0.629	negative regulation of biological process
GO:0051179	0.552	localization
GO:0034389	0.534	lipid droplet organization
GO:0033036	0.473	macromolecule localization
GO:0010876	0.464	lipid localization
GO:0071704	0.400	organic substance metabolic process
GO:0044238	0.352	primary metabolic process
GO:0044237	0.338	cellular metabolic process
GO:0010889	0.307	regulation of sequestering of triglyceride

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005811	1.000	lipid droplet
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005737	0.977	cytoplasm
GO:0005829	0.730	cytosol
GO:0016020	0.445	membrane
GO:0005739	0.353	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]