StarFunc result for job id Q01064

User Input

>input (536 residues)
MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNL
EYTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKP
KFRSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHAL
RTIVFELLTRHNLISRFKIPTVFLMSFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLL
RTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKSECAIVYNDRSVLENHHISSV
FRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTALQQLERIDKPK
ALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS
QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVS
FRSTWVKRIQENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01064	1.000	1.000	1.992E-66	536	1.000	1.000	Q01064.pdb.gz	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
2	AFDB:Q61481	0.773	0.760	1.058E-39	545	0.558	0.549	Q61481.pdb.gz	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
3	AFDB:E7F6Z8	0.623	0.547	1.607E-36	611	0.578	0.507	E7F6Z8.pdb.gz	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
4	AFDB:Q63421	0.601	0.420	1.702E-35	768	0.590	0.411	Q63421.pdb.gz	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
5	AFDB:O18696	0.617	0.502	9.737E-33	664	0.457	0.369	O18696.pdb.gz	PDE1_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-1 OS=Caenorhabditis elegans OX=6239 GN=pde-1 PE=1 SV=2
6	AFDB:B7YZV4	0.635	0.413	1.228E-28	834	0.416	0.267	B7YZV4.pdb.gz	PDE1_DROME Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1 OS=Drosophila melanogaster OX=7227 GN=Pde1c PE=1 SV=1
7	AFDB:Q2V4U0	0.621	0.499	3.767E-22	673	0.271	0.215	Q2V4U0.pdb.gz	Q2V4U0_CAEEL Phosphodiesterase OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=1 SV=1
8	AFDB:Q22000	0.610	0.489	4.809E-22	674	0.280	0.223	Q22000.pdb.gz	PDE4_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-4 OS=Caenorhabditis elegans OX=6239 GN=pde-4 PE=2 SV=2
9	AFDB:B1AWC9	0.537	0.395	2.657E-21	736	0.285	0.208	B1AWC9.pdb.gz	B1AWC9_MOUSE Phosphodiesterase OS=Mus musculus OX=10090 GN=Pde4b PE=1 SV=1
10	AFDB:A0A140VJR0	0.569	0.383	3.832E-21	809	0.295	0.195	A0A140VJR0.pdb.gz	A0A140VJR0_HUMAN Phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE4D PE=2 SV=1
11	PDB:4y86B	0.544	0.881	4.393E-16	326	0.177	0.291	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	PDB:6mzbB	0.538	0.362	4.166E-12	807	0.168	0.112	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
13	PDB:7jsnA	0.533	0.354	4.339E-12	820	0.179	0.117	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
14	PDB:3bjcA	0.495	0.827	1.956E-11	311	0.144	0.248	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
15	PDB:6zp4C	0.092	0.084	2.736E-1	633	0.116	0.098	6zp4C.pdb.gz	Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.
16	PDB:7lbm2	0.098	0.073	5.928E-1	897	0.125	0.075	7lbm2.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	PDB:3lvsB	0.127	0.189	7.266E-1	274	0.058	0.113	3lvsB.pdb.gz
18	PDB:1yfmA	0.140	0.162	7.882E-1	450	0.093	0.111	1yfmA.pdb.gz
19	PDB:3ts7B	0.172	0.257	8.550E-1	297	0.060	0.108	3ts7B.pdb.gz
20	PDB:3aqbD	0.135	0.184	9.661E-1	325	0.063	0.105	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZX9	548	465	0.502	0.578	A0A0G2JZX9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
2	A0A0G2K2K1	609	515	0.554	0.577	A0A0G2K2K1_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
3	A0A2R8RXK7	631	587	0.569	0.520	A0A2R8RXK7_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=1
4	A0A8I5Y792	561	515	0.526	0.548	A0A8I5Y792_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
5	A0A8I5Y879	607	508	0.554	0.585	A0A8I5Y879_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
6	A0A8I6A416	621	542	0.567	0.561	A0A8I6A416_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
7	A0A8I6A5M3	607	526	0.554	0.565	A0A8I6A5M3_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
8	A0A8I6GJQ6	553	508	0.507	0.535	A0A8I6GJQ6_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
9	E7F6Z8	639	611	0.580	0.509	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
10	P14100	649	530	0.562	0.568	PDE1A_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Bos taurus OX=9913 GN=PDE1A PE=1 SV=3
11	P54750	627	535	0.571	0.572	PDE1A_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2
12	Q01061	1070	534	0.961	0.964	PDE1B_BOVIN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Bos taurus OX=9913 GN=PDE1B PE=1 SV=1
13	Q01064	1116	536	1.000	1.000	PDE1B_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Homo sapiens OX=9606 GN=PDE1B PE=1 SV=2
14	Q01065	1072	535	0.959	0.961	PDE1B_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Mus musculus OX=10090 GN=Pde1b PE=1 SV=2
15	Q01066	1073	535	0.959	0.961	PDE1B_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Rattus norvegicus OX=10116 GN=Pde1b PE=1 SV=1
16	Q14123	645	709	0.588	0.444	PDE1C_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Homo sapiens OX=9606 GN=PDE1C PE=1 SV=1
17	Q61481	625	545	0.575	0.565	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
18	Q63421	637	768	0.580	0.405	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
19	Q64338	647	706	0.588	0.446	PDE1C_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus OX=10090 GN=Pde1c PE=1 SV=2
20	Q64395	1077	535	0.961	0.963	PDE1B_CRIGR Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B OS=Cricetulus griseus OX=10029 GN=PDE1B1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18177 La_HTH_kDCL	2.9e+02	13.0	La HTH in kinetoplastid DICER domain
2	PF00233 PDEase_I	2.3e-80	281.3	3'5'-cyclic nucleotide phosphodiesterase
3	PF08499 PDEase_I_N	4.7e-30	114.6	3'5'-cyclic nucleotide phosphodiesterase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243052

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.923	Adenosine kinase
2	9606.ENSP00000485525	0.915	Adenylosuccinate lyase
3	9606.ENSP00000272298	0.904	Calmodulin 2 (phosphorylase kinase, delta)
4	9606.ENSP00000286648	0.904	Deoxycytidine kinase
5	9606.ENSP00000371230	0.901	GTP:AMP phosphotransferase AK3, mitochondrial
6	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
7	9606.ENSP00000379496	0.857	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C
8	9606.ENSP00000419361	0.831	Adenylate cyclase type 5
9	9606.ENSP00000410309	0.810	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
10	9606.ENSP00000248150	0.809	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
11	9606.ENSP00000381339	0.804	Guanine nucleotide-binding protein G(t) subunit alpha-3
12	9606.ENSP00000229264	0.802	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
13	9606.ENSP00000450385	0.798	Myosin light chain 6B
14	9606.ENSP00000349467	0.786	Calmodulin-1
15	9606.ENSP00000291295	0.782	Calmodulin 3 (phosphorylase kinase, delta)
16	9606.ENSP00000264424	0.765	Guanylate cyclase soluble subunit beta-1
17	9606.ENSP00000356825	0.759	Adenylate cyclase type 10
18	9606.ENSP00000282249	0.754	Guanylate cyclase soluble subunit alpha-2
19	9606.ENSP00000296518	0.754	Guanylate cyclase 1, soluble, alpha 3
20	9606.ENSP00000297323	0.751	Adenylate cyclase type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047555	0.998	3',5'-cyclic-GMP phosphodiesterase activity
GO:0004115	0.998	3',5'-cyclic-AMP phosphodiesterase activity
GO:0005488	0.995	binding
GO:0005515	0.992	protein binding
GO:0004117	0.529	calmodulin-activated dual specificity 3',5'-cyclic-GMP, 3',5'-cyclic-AMP phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.967	response to stimulus
GO:0050789	0.811	regulation of biological process
GO:0050794	0.795	regulation of cellular process
GO:0008152	0.765	metabolic process
GO:0071704	0.725	organic substance metabolic process
GO:0051716	0.722	cellular response to stimulus
GO:0044237	0.703	cellular metabolic process
GO:0006807	0.663	nitrogen compound metabolic process
GO:0042221	0.633	response to chemical
GO:0007154	0.560	cell communication
GO:0007165	0.554	signal transduction
GO:1901360	0.535	organic cyclic compound metabolic process
GO:0006725	0.534	cellular aromatic compound metabolic process
GO:0044238	0.531	primary metabolic process
GO:0034641	0.515	cellular nitrogen compound metabolic process
GO:0032501	0.505	multicellular organismal process
GO:0046483	0.475	heterocycle metabolic process
GO:0044281	0.442	small molecule metabolic process
GO:0006139	0.433	nucleobase-containing compound metabolic process
GO:0055086	0.407	nucleobase-containing small molecule metabolic process
GO:0006753	0.399	nucleoside phosphate metabolic process
GO:1901564	0.398	organonitrogen compound metabolic process
GO:0009117	0.394	nucleotide metabolic process
GO:0006163	0.356	purine nucleotide metabolic process
GO:0009150	0.349	purine ribonucleotide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.986	cytosol
GO:0043231	0.831	intracellular membrane-bounded organelle
GO:0005634	0.649	nucleus
GO:0036477	0.430	somatodendritic compartment
GO:0043025	0.400	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	0.998	3',5'-cyclic AMP + H2O = AMP + H(+)
RHEA:16957	0.998	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.53	0.998	3',5'-cyclic-AMP phosphodiesterase.
EC:3.1.4.35	0.998	3',5'-cyclic-GMP phosphodiesterase.

[back to server]