StarFunc result for job id Q01082

User Input

>input (2364 residues)
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQ
SLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
RETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPEPSTKVSEEAESQQQWDTSKGEQVSQNGLPAEQGSPRMAETVDTSEMVNGATEQRTS
SKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSR
SWHNVYCVINNQEMGFYKDAKTAASGIPYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLN
DGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSASTQSTPASSRAQTLPTSVVTITSES
SPGKREKDKEKDKEKRFSLFGKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0AHA7	0.306	0.310	0.000	2326	0.498	0.506	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
2	AFDB:F1QQE5	0.428	0.429	0.000	2357	0.618	0.619	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
3	AFDB:O15020	0.461	0.457	0.000	2390	0.629	0.622	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:P11277	0.343	0.373	0.000	2137	0.547	0.605	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
5	AFDB:Q00963	0.226	0.231	0.000	2291	0.543	0.560	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
6	AFDB:Q01082	1.000	1.000	0.000	2364	1.000	1.000	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:Q9H254	0.474	0.445	0.000	2564	0.512	0.472	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
8	AFDB:A4QPE4	0.240	0.573	1.917E-67	934	0.208	0.526	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
9	AFDB:Q23158	0.099	0.247	5.250E-41	920	0.121	0.310	Q23158.pdb.gz	Q23158_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
10	AFDB:P05094	0.169	0.397	8.666E-41	893	0.117	0.310	P05094.pdb.gz	ACTN1_CHICK Alpha-actinin-1 OS=Gallus gallus OX=9031 GN=ACTN1 PE=1 SV=3
11	PDB:4d1eA	0.161	0.299	1.706E-32	859	0.112	0.307	4d1eA.pdb.gz
12	PDB:1sjjA	0.108	0.253	1.443E-27	863	0.121	0.333	1sjjA.pdb.gz
13	PDB:7sukSP	0.046	0.047	5.011E-7	2234	0.100	0.106	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
14	PDB:7sx8D	0.079	0.355	1.216E-5	448	0.023	0.121	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
15	PDB:7mqaLM	0.044	0.047	5.727E-5	2041	0.099	0.115	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7z8fe	0.051	0.032	3.386E-4	4579	0.077	0.040	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
17	PDB:6bbpA	0.037	0.161	5.102E-4	520	0.008	0.037	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:7n6g1N	0.042	0.045	1.328E-3	2179	0.091	0.099	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
19	PDB:7sglA	0.039	0.029	1.390E-3	3852	0.094	0.058	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
20	PDB:6u3eA	0.035	0.195	1.455E-3	397	0.010	0.058	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZY6	4243	2152	0.876	0.963	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
2	A0A0G2K677	2152	2561	0.475	0.439	A0A0G2K677_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=1 SV=1
3	A0A140UHX6	2637	2117	0.541	0.604	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
4	A0A8I6ASR7	2151	2542	0.475	0.442	A0A8I6ASR7_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn4 PE=3 SV=1
5	A0A8I6AWM3	2805	2329	0.584	0.593	A0A8I6AWM3_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
6	A0A8I6G9M6	2803	2325	0.585	0.594	A0A8I6G9M6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1
7	A4QPE4	1031	934	0.210	0.531	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
8	A8JNJ6	797	4337	0.264	0.144	A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=2
9	E0AHA7	2318	2326	0.501	0.509	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
10	E9PX29	2152	2561	0.476	0.439	E9PX29_MOUSE Spectrin beta chain OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
11	E9PZC2	835	1241	0.182	0.347	E9PZC2_MOUSE Spectrin beta, non-erythrocytic 4 OS=Mus musculus OX=10090 GN=Sptbn4 PE=1 SV=1
12	F1QQE5	2933	2357	0.620	0.622	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
13	F6W8M4	2972	2390	0.629	0.623	F6W8M4_MACMU Spectrin beta chain OS=Macaca mulatta OX=9544 GN=SPTBN2 PE=3 SV=3
14	F7HAE6	838	3697	0.258	0.165	F7HAE6_MACMU Spectrin beta, non-erythrocytic 5 OS=Macaca mulatta OX=9544 GN=SPTBN5 PE=3 SV=3
15	G3V6S0	4784	2361	0.982	0.983	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
16	G5EG85	2346	2257	0.508	0.532	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
17	M9PBL6	796	4321	0.264	0.144	M9PBL6_DROME Karst, isoform G OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
18	O15020	2992	2390	0.630	0.623	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
19	P11277	2672	2137	0.544	0.602	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
20	P15508	2623	2128	0.536	0.596	SPTB1_MOUSE Spectrin beta chain, erythrocytic OS=Mus musculus OX=10090 GN=Sptb PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	3.9e-06	37.9	CAMSAP CH domain
2	PF11802 CENP-K	7.2	17.7	Centromere-associated protein K
3	PF00307 CH	5.6e-49	176.2	Calponin homology (CH) domain
4	PF00169 PH	8.1e-14	63.4	PH domain
5	PF15410 PH_9	2.2e-15	68.3	Pleckstrin homology domain
6	PF18169 SLATT_6	1.4	20.0	SMODS and SLOG-associating 2TM effector domain 6
7	PF00435 Spectrin	0	1060.5	Spectrin repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361824	0.999	Spectrin alpha chain, non-erythrocytic 1
2	9606.ENSP00000349588	0.996	Ankyrin-2
3	9606.ENSP00000344666	0.987	Merlin
4	9606.ENSP00000280772	0.973	Ankyrin-3
5	9606.ENSP00000332973	0.973	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000364133	0.938	TGF-beta receptor type-1
7	9606.ENSP00000256078	0.930	GTPase KRas
8	9606.ENSP00000343158	0.925	Band 4.1-like protein 3
9	9606.ENSP00000407586	0.925	GTPase HRas
10	9606.ENSP00000351905	0.923	TGF-beta receptor type-2
11	9606.ENSP00000358548	0.920	GTPase NRas
12	9606.ENSP00000362680	0.916	Proto-oncogene tyrosine-protein kinase Src
13	9606.ENSP00000221930	0.910	Transforming growth factor beta-1
14	9606.ENSP00000238682	0.902	Transforming growth factor beta-3
15	9606.ENSP00000357129	0.882	Spectrin alpha chain, erythrocytic 1
16	9606.ENSP00000265709	0.861	Ankyrin-1
17	9606.ENSP00000344786	0.851	Neurofascin
18	9606.ENSP00000338481	0.833	Band 4.1-like protein 2
19	9606.ENSP00000480132	0.825	Neural cell adhesion molecule 1
20	9606.ENSP00000317790	0.790	Spectrin beta, non-erythrocytic 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.999	actin binding
GO:0030506	0.936	ankyrin binding
GO:0005198	0.905	structural molecule activity
GO:0044877	0.903	protein-containing complex binding
GO:0050839	0.805	cell adhesion molecule binding
GO:0097159	0.776	organic cyclic compound binding
GO:1901363	0.719	heterocyclic compound binding
GO:0003676	0.670	nucleic acid binding
GO:0005200	0.596	structural constituent of cytoskeleton
GO:0045296	0.590	cadherin binding
GO:0019899	0.319	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.970	biological regulation
GO:0050789	0.955	regulation of biological process
GO:0051179	0.915	localization
GO:0071840	0.858	cellular component organization or biogenesis
GO:0016043	0.854	cellular component organization
GO:0050794	0.845	regulation of cellular process
GO:0032502	0.837	developmental process
GO:0032501	0.784	multicellular organismal process
GO:0048856	0.703	anatomical structure development
GO:0051234	0.700	establishment of localization
GO:0006810	0.691	transport
GO:0051641	0.672	cellular localization
GO:0050896	0.468	response to stimulus
GO:0007275	0.464	multicellular organism development
GO:0016192	0.424	vesicle-mediated transport
GO:0048518	0.423	positive regulation of biological process
GO:0048522	0.367	positive regulation of cellular process
GO:0022607	0.331	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005622	0.998	intracellular anatomical structure
GO:0030054	0.996	cell junction
GO:0005737	0.992	cytoplasm
GO:0005886	0.990	plasma membrane
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0032991	0.985	protein-containing complex
GO:0045202	0.953	synapse
GO:0043227	0.943	membrane-bounded organelle
GO:0098794	0.938	postsynapse
GO:0005856	0.919	cytoskeleton
GO:0043231	0.917	intracellular membrane-bounded organelle
GO:0098978	0.870	glutamatergic synapse
GO:0005829	0.865	cytosol
GO:0005576	0.824	extracellular region
GO:0015629	0.743	actin cytoskeleton
GO:0031982	0.679	vesicle
GO:0005634	0.679	nucleus
GO:0005615	0.610	extracellular space
GO:0043233	0.576	organelle lumen
GO:0070013	0.566	intracellular organelle lumen
GO:0043230	0.546	extracellular organelle
GO:0065010	0.540	extracellular membrane-bounded organelle
GO:0012505	0.531	endomembrane system
GO:0070062	0.528	extracellular exosome
GO:0031981	0.526	nuclear lumen
GO:0005654	0.379	nucleoplasm
GO:0008091	0.375	spectrin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]