StarFunc result for job id Q01094

User Input

>input (437 residues)
MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCD
PDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVK
SPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLI
AKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDS
QRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPE
ETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLS
RMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEG
IRDLFDCDFGDLTPLDF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01094	1.000	1.000	4.042E-74	437	1.000	1.000	Q01094.pdb.gz	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
2	AFDB:O09139	0.599	0.605	8.011E-63	432	0.849	0.859	O09139.pdb.gz	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
3	AFDB:P56931	0.387	0.383	7.291E-28	443	0.410	0.404	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
4	AFDB:Q14209	0.375	0.375	9.445E-28	437	0.410	0.410	Q14209.pdb.gz	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
5	AFDB:O00716	0.401	0.380	8.524E-27	465	0.412	0.387	O00716.pdb.gz	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
6	AFDB:A0A0S2Z3K8	0.390	0.585	2.929E-21	281	0.245	0.381	A0A0S2Z3K8.pdb.gz	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
7	AFDB:Q15329	0.274	0.334	7.732E-21	346	0.256	0.324	Q15329.pdb.gz	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
8	AFDB:Q9FV71	0.311	0.293	5.748E-20	469	0.272	0.254	Q9FV71.pdb.gz	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
9	AFDB:O54917	0.374	0.577	1.098E-19	272	0.224	0.360	O54917.pdb.gz	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
10	AFDB:Q16254	0.266	0.280	2.019E-18	413	0.288	0.305	Q16254.pdb.gz	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
11	PDB:4ev0D	0.129	0.247	3.728E-2	214	0.016	0.033	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
12	PDB:5l4kR	0.119	0.132	4.526E-2	389	0.032	0.036	5l4kR.pdb.gz
13	PDB:1z9cC	0.119	0.334	6.673E-2	138	0.050	0.159	1z9cC.pdb.gz	Structure of an OhrR-ohrA Operator Complex Reveals the DNA Binding Mechanism of the MarR Family.
14	PDB:5u8s4	0.122	0.080	6.673E-2	682	0.014	0.009	5u8s4.pdb.gz	Structure of eukaryotic CMG helicase at a replication fork and implications to replisome architecture and origin initiation.
15	PDB:5l4kO	0.141	0.160	9.223E-2	376	0.030	0.035	5l4kO.pdb.gz
16	PDB:6r7nB	0.139	0.137	9.223E-2	443	0.021	0.020	6r7nB.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:3dkwA	0.111	0.196	9.839E-2	227	0.032	0.062	3dkwA.pdb.gz
18	PDB:4v6iAV	0.128	0.566	9.839E-2	85	0.027	0.141	4v6iAV.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
19	PDB:1ft9A	0.117	0.231	1.195E-1	210	0.018	0.038	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
20	PDB:5v8f4	0.132	0.080	1.195E-1	741	0.023	0.013	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O09139	0.0	645	432	0.854	0.863	E2F1_RAT Transcription factor E2F1 OS=Rattus norvegicus OX=10116 GN=E2f1 PE=1 SV=2
2	Q01094	0.0	877	437	1.000	1.000	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
3	Q61501	0.0	629	430	0.835	0.849	E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus OX=10090 GN=E2f1 PE=1 SV=1
4	O00716	5.53e-84	267	465	0.405	0.381	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
5	O35261	2.34e-81	259	457	0.396	0.379	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
6	Q14209	7.78e-81	258	437	0.394	0.394	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
7	P56931	3.69e-78	251	443	0.405	0.400	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
8	A0A0S2Z3K8	2.78e-44	157	281	0.217	0.338	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
9	O75461	2.78e-44	157	281	0.217	0.338	E2F6_HUMAN Transcription factor E2F6 OS=Homo sapiens OX=9606 GN=E2F6 PE=1 SV=1
10	O54917	1.06e-42	153	272	0.206	0.331	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
11	Q53YM3	7.04e-37	135	206	0.165	0.350	Q53YM3_HUMAN E2F transcription factor 6, isoform CRA_d OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
12	Q9FV70	1.76e-35	137	396	0.172	0.189	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
13	Q15329	6.99e-34	131	346	0.247	0.312	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
14	Q9FNY0	1.12e-33	134	485	0.178	0.161	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
15	Q27368	1.57e-33	135	805	0.176	0.096	E2F1_DROME Transcription factor E2f1 OS=Drosophila melanogaster OX=7227 GN=E2f1 PE=1 SV=2
16	Q16254	4.36e-33	130	413	0.185	0.196	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
17	Q9FV71	5.34e-33	131	469	0.190	0.177	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
18	Q8R0K9	7.66e-33	130	410	0.185	0.198	E2F4_MOUSE Transcription factor E2F4 OS=Mus musculus OX=10090 GN=E2f4 PE=1 SV=1
19	Q62814	1.72e-32	127	300	0.243	0.353	E2F5_RAT Transcription factor E2F5 (Fragment) OS=Rattus norvegicus OX=10116 GN=E2f5 PE=2 SV=1
20	Q61502	2.25e-32	127	335	0.245	0.319	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16421 E2F_CC-MB	2.5e-26	103.1	E2F transcription factor CC-MB domain
2	PF02319 E2F_TDP	6.9e-22	88.4	E2F/DP family winged-helix DNA-binding domain
3	PF02079 TP1	1.6e+02	13.6	Nuclear transition protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267163	0.999	Retinoblastoma-associated protein
2	9606.ENSP00000362768	0.999	Retinoblastoma-like protein 1
3	9606.ENSP00000364519	0.999	Transcription factor Dp-1
4	9606.ENSP00000274026	0.998	Cyclin-A2
5	9606.ENSP00000260810	0.996	DNA topoisomerase 2-binding protein 1
6	9606.ENSP00000266970	0.996	Cyclin-dependent kinase 2
7	9606.ENSP00000332643	0.994	Necdin
8	9606.ENSP00000362649	0.992	Histone deacetylase 1
9	9606.ENSP00000375942	0.989	TATA-box-binding protein
10	9606.ENSP00000420616	0.989	Transcription factor Dp-2
11	9606.ENSP00000262133	0.988	Retinoblastoma-like protein 2
12	9606.ENSP00000418915	0.988	Cyclin-dependent kinase inhibitor 2A
13	9606.ENSP00000255465	0.987	Cyclin-A1
14	9606.ENSP00000263754	0.987	Histone acetyltransferase KAT2B
15	9606.ENSP00000209728	0.986	Cell division control protein 6 homolog
16	9606.ENSP00000257904	0.986	Cyclin-dependent kinase 4
17	9606.ENSP00000258149	0.984	E3 ubiquitin-protein ligase Mdm2
18	9606.ENSP00000330694	0.983	Non-structural maintenance of chromosomes element 3 homolog
19	9606.ENSP00000378699	0.983	Cyclin-dependent kinase 1
20	9606.ENSP00000262643	0.980	G1/S-specific cyclin-E1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000981	0.973	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.961	cis-regulatory region sequence-specific DNA binding
GO:0001216	0.946	DNA-binding transcription activator activity
GO:0008134	0.709	transcription factor binding
GO:0140297	0.590	DNA-binding transcription factor binding
GO:0019899	0.436	enzyme binding
GO:0060090	0.406	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0010556	0.995	regulation of macromolecule biosynthetic process
GO:0031326	0.995	regulation of cellular biosynthetic process
GO:0051173	0.991	positive regulation of nitrogen compound metabolic process
GO:0050896	0.989	response to stimulus
GO:0010468	0.988	regulation of gene expression
GO:1903506	0.987	regulation of nucleic acid-templated transcription
GO:0006355	0.984	regulation of DNA-templated transcription
GO:0042127	0.977	regulation of cell population proliferation
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0031325	0.958	positive regulation of cellular metabolic process
GO:0051716	0.949	cellular response to stimulus
GO:0045935	0.942	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.884	positive regulation of RNA metabolic process
GO:0010557	0.883	positive regulation of macromolecule biosynthetic process
GO:0031328	0.878	positive regulation of cellular biosynthetic process
GO:0048519	0.877	negative regulation of biological process
GO:0048523	0.853	negative regulation of cellular process
GO:0008152	0.830	metabolic process
GO:0006950	0.821	response to stress
GO:1903508	0.821	positive regulation of nucleic acid-templated transcription
GO:0071704	0.813	organic substance metabolic process
GO:0044238	0.805	primary metabolic process
GO:0045893	0.787	positive regulation of DNA-templated transcription
GO:0006807	0.782	nitrogen compound metabolic process
GO:0006357	0.747	regulation of transcription by RNA polymerase II
GO:0051726	0.745	regulation of cell cycle
GO:0033554	0.722	cellular response to stress
GO:0043170	0.721	macromolecule metabolic process
GO:0000278	0.706	mitotic cell cycle
GO:1903047	0.672	mitotic cell cycle process
GO:0007154	0.668	cell communication
GO:0045944	0.633	positive regulation of transcription by RNA polymerase II
GO:0044237	0.624	cellular metabolic process
GO:0007165	0.614	signal transduction
GO:0035556	0.588	intracellular signal transduction
GO:0051172	0.486	negative regulation of nitrogen compound metabolic process
GO:0031324	0.486	negative regulation of cellular metabolic process
GO:0065009	0.482	regulation of molecular function
GO:0010605	0.482	negative regulation of macromolecule metabolic process
GO:0010564	0.439	regulation of cell cycle process
GO:0006974	0.428	cellular response to DNA damage stimulus
GO:0045934	0.427	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.419	negative regulation of biosynthetic process
GO:0010558	0.412	negative regulation of macromolecule biosynthetic process
GO:0031327	0.410	negative regulation of cellular biosynthetic process
GO:0032502	0.388	developmental process
GO:0051253	0.385	negative regulation of RNA metabolic process
GO:0045892	0.378	negative regulation of DNA-templated transcription
GO:0071840	0.365	cellular component organization or biogenesis
GO:1901990	0.328	regulation of mitotic cell cycle phase transition
GO:0016043	0.325	cellular component organization
GO:0044772	0.318	mitotic cell cycle phase transition
GO:0006139	0.315	nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	0.999	nucleoplasm
GO:0005667	0.991	transcription regulator complex
GO:0005737	0.970	cytoplasm
GO:0140513	0.904	nuclear protein-containing complex
GO:0000785	0.774	chromatin
GO:0090575	0.739	RNA polymerase II transcription regulator complex
GO:0005829	0.477	cytosol
GO:0005813	0.370	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]