StarFunc result for job id Q01101

User Input

>input (510 residues)
MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAE
RAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSF
NLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAA
RGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLHFEDEVTTSPV
LGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPEC
AKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRDTPSPGGVSES
GSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYS
SPGLTRHINKCHPSENRQVILLQVPVRPAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULJ3	0.143	0.082	2.188E-8	1066	0.171	0.082	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
2	AFDB:P20662	0.109	0.085	7.384E-7	777	0.155	0.102	P20662.pdb.gz	ZFY2_MOUSE Zinc finger Y-chromosomal protein 2 OS=Mus musculus OX=10090 GN=Zfy2 PE=2 SV=2
3	AFDB:Q9Y462	0.123	0.091	5.366E-6	761	0.161	0.108	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
4	AFDB:A7Y7X5	0.118	0.088	1.698E-5	761	0.147	0.099	A7Y7X5.pdb.gz	ZN711_DANRE Zinc finger protein 711 OS=Danio rerio OX=7955 GN=znf711 PE=1 SV=1
5	AFDB:A0A024RC04	0.096	0.068	6.507E-5	805	0.155	0.098	A0A024RC04.pdb.gz
6	AFDB:R9PY21	0.109	0.085	7.395E-5	720	0.176	0.125	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
7	AFDB:M9NEG1	0.082	0.047	1.018E-4	1109	0.173	0.079	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
8	AFDB:Q8I7Z8	0.088	0.055	2.339E-4	990	0.208	0.107	Q8I7Z8.pdb.gz	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
9	AFDB:Q8K1M4	0.105	0.076	4.729E-4	789	0.190	0.123	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
10	AFDB:Q7Z4V0	0.119	0.083	7.401E-4	828	0.192	0.118	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
11	PDB:3w5kB	0.065	0.215	1.213E-1	110	0.063	0.291	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4z4kA	0.067	0.107	6.007E-1	282	0.024	0.043	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
13	PDB:4c2mI	0.041	0.124	2.454	124	0.027	0.113	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
14	PDB:6ydhA	0.038	0.218	2.454	62	0.018	0.145	6ydhA.pdb.gz
15	PDB:5dkaA	0.055	0.250	2.974	96	0.020	0.104	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7pfoB	0.050	0.037	3.603	759	0.018	0.012	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
17	PDB:3gn5A	0.031	0.084	4.095	132	0.018	0.068	3gn5A.pdb.gz	Three dimensional structure of the MqsR:MqsA complex: a novel TA pair comprised of a toxin homologous to RelE and an antitoxin with unique properties.
18	PDB:4r8pL	0.054	0.091	4.365	254	0.045	0.091	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
19	PDB:1booA	0.047	0.069	6.011	282	0.027	0.050	1booA.pdb.gz	Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment.
20	PDB:7ohsH	0.043	0.114	6.011	156	0.004	0.013	7ohsH.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GJX9	0.0	663	522	0.855	0.835	A0A8I6GJX9_RAT INSM transcriptional repressor 1 OS=Rattus norvegicus OX=10116 GN=Insm1 PE=4 SV=1
2	Q01101	0.0	991	510	1.000	1.000	INSM1_HUMAN Insulinoma-associated protein 1 OS=Homo sapiens OX=9606 GN=INSM1 PE=1 SV=1
3	Q63ZV0	0.0	702	521	0.876	0.858	INSM1_MOUSE Insulinoma-associated protein 1 OS=Mus musculus OX=10090 GN=Insm1 PE=1 SV=1
4	A7UKY7	3.55e-155	451	433	0.569	0.670	INSM1_XENLA Insulinoma-associated protein 1 OS=Xenopus laevis OX=8355 GN=insm1 PE=2 SV=1
5	Q6P0F9	4.03e-153	444	383	0.512	0.681	INS1A_DANRE Insulinoma-associated protein 1a OS=Danio rerio OX=7955 GN=insm1a PE=2 SV=1
6	Q9V3B8	3.93e-33	133	469	0.157	0.171	Q9V3B8_DROME LD18634p OS=Drosophila melanogaster OX=7227 GN=nerfin-1 PE=2 SV=1
7	G5EFY4	2.71e-26	110	286	0.114	0.203	EGL46_CAEEL Transcription factor egl-46 OS=Caenorhabditis elegans OX=6239 GN=egl-46 PE=1 SV=1
8	P13360	4.05e-09	61.2	604	0.094	0.079	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
9	Q96BV0	2.22e-08	58.9	537	0.127	0.121	ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens OX=9606 GN=ZNF775 PE=1 SV=2
10	Q96NG5	3.62e-08	57.8	402	0.108	0.137	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
11	P14404	5.91e-08	58.2	1232	0.086	0.036	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
12	O15015	6.66e-08	58.2	1832	0.118	0.033	ZN646_HUMAN Zinc finger protein 646 OS=Homo sapiens OX=9606 GN=ZNF646 PE=1 SV=2
13	A2A935	1.07e-07	57.4	1275	0.088	0.035	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
14	P59923	1.96e-07	56.2	1031	0.110	0.054	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
15	Q96SZ4	2.13e-07	56.2	725	0.108	0.076	ZSC10_HUMAN Zinc finger and SCAN domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ZSCAN10 PE=1 SV=1
16	Q923T4	2.45e-07	55.5	484	0.120	0.126	Q923T4_MOUSE Zinc finger protein ZFEND OS=Mus musculus OX=10090 GN=Zfp358 PE=2 SV=1
17	Q96MX3	2.75e-07	55.5	618	0.120	0.099	ZNF48_HUMAN Zinc finger protein 48 OS=Homo sapiens OX=9606 GN=ZNF48 PE=1 SV=2
18	Q8CF60	2.98e-07	55.5	680	0.108	0.081	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
19	Q13105	3.59e-07	55.5	803	0.102	0.065	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
20	O14978	3.91e-07	55.1	683	0.098	0.073	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	4.8e-12	56.8	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	4e-12	56.9	C2H2-type zinc finger
3	PF13912 zf-C2H2_6	0.19	23.0	C2H2-type zinc finger
4	PF12171 zf-C2H2_jaz	0.047	25.2	Zinc-finger double-stranded RNA-binding
5	PF05605 zf-Di19	1.7e+02	13.9	Drought induced 19 protein (Di19), zinc-binding
6	PF12874 zf-met	0.56	21.9	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312631

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242462	0.970	Neurogenin-3
2	9606.ENSP00000383042	0.970	Lysine-specific histone demethylase 1A
3	9606.ENSP00000295718	0.940	Receptor-type tyrosine-protein phosphatase-like N
4	9606.ENSP00000227507	0.912	G1/S-specific cyclin-D1
5	9606.ENSP00000262241	0.836	REST corepressor 1
6	9606.ENSP00000360293	0.806	Sorbin and SH3 domain-containing protein 1
7	9606.ENSP00000435233	0.805	Transcriptional enhancer factor TEF-1
8	9606.ENSP00000295108	0.729	Neurogenic differentiation factor 1
9	9606.ENSP00000366347	0.698	Homeobox protein Nkx-2.2
10	9606.ENSP00000241014	0.696	C-Jun-amino-terminal kinase-interacting protein 1
11	9606.ENSP00000362649	0.695	Histone deacetylase 1
12	9606.ENSP00000266744	0.694	Achaete-scute homolog 1
13	9606.ENSP00000332208	0.679	DNA-binding protein RFX6
14	9606.ENSP00000472109	0.672	Transcriptional enhancer factor TEF-4
15	9606.ENSP00000352926	0.663	Transcriptional enhancer factor TEF-3
16	9606.ENSP00000345772	0.662	Transcriptional enhancer factor TEF-5
17	9606.ENSP00000216492	0.654	Chromogranin-A
18	9606.ENSP00000339906	0.646	Paired box protein Pax-4
19	9606.ENSP00000384719	0.630	Visinin-like protein 1
20	9606.ENSP00000404100	0.593	Paired box protein Pax-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.962	DNA binding
GO:0043565	0.944	sequence-specific DNA binding
GO:1990837	0.831	sequence-specific double-stranded DNA binding
GO:0001067	0.655	transcription regulatory region nucleic acid binding
GO:0000976	0.653	transcription cis-regulatory region binding
GO:0140110	0.511	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.998	regulation of metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.989	regulation of nitrogen compound metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0009987	0.978	cellular process
GO:0019219	0.971	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0048519	0.945	negative regulation of biological process
GO:0048523	0.939	negative regulation of cellular process
GO:0010605	0.931	negative regulation of macromolecule metabolic process
GO:0006355	0.930	regulation of DNA-templated transcription
GO:0051172	0.917	negative regulation of nitrogen compound metabolic process
GO:0031324	0.917	negative regulation of cellular metabolic process
GO:0032502	0.855	developmental process
GO:0045934	0.815	negative regulation of nucleobase-containing compound metabolic process
GO:0006357	0.778	regulation of transcription by RNA polymerase II
GO:0051253	0.740	negative regulation of RNA metabolic process
GO:0009890	0.729	negative regulation of biosynthetic process
GO:0032501	0.680	multicellular organismal process
GO:0048518	0.672	positive regulation of biological process
GO:0048522	0.645	positive regulation of cellular process
GO:0048856	0.636	anatomical structure development
GO:0010558	0.635	negative regulation of macromolecule biosynthetic process
GO:0031327	0.585	negative regulation of cellular biosynthetic process
GO:1902679	0.581	negative regulation of RNA biosynthetic process
GO:0045892	0.549	negative regulation of DNA-templated transcription
GO:0044087	0.532	regulation of cellular component biogenesis
GO:0007275	0.526	multicellular organism development
GO:0042127	0.484	regulation of cell population proliferation
GO:0009893	0.456	positive regulation of metabolic process
GO:0051726	0.454	regulation of cell cycle
GO:0048731	0.447	system development
GO:0030154	0.427	cell differentiation
GO:0010604	0.395	positive regulation of macromolecule metabolic process
GO:0031325	0.377	positive regulation of cellular metabolic process
GO:0051173	0.348	positive regulation of nitrogen compound metabolic process
GO:0000122	0.334	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.991	protein-containing complex
GO:0005667	0.840	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]