StarFunc result for job id Q01105

User Input

>input (290 residues)
MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNE
QASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYL
TRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLT
KRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDD
EEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DME0	0.818	0.787	3.433E-44	302	0.938	0.901	P0DME0.pdb.gz	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
2	AFDB:Q63945	0.861	0.864	7.164E-44	289	0.941	0.945	Q63945.pdb.gz	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
3	AFDB:A0A2R8QJ70	0.725	0.732	1.606E-38	287	0.797	0.805	A0A2R8QJ70.pdb.gz
4	AFDB:Q8LC68	0.627	0.709	3.139E-22	255	0.352	0.400	Q8LC68.pdb.gz	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
5	AFDB:Q9CA59	0.581	0.652	1.642E-21	256	0.372	0.422	Q9CA59.pdb.gz	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
6	AFDB:Q9H2G4	0.600	0.256	1.793E-20	693	0.259	0.108	Q9H2G4.pdb.gz	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
7	AFDB:Q86VY4	0.610	0.435	4.230E-20	417	0.328	0.228	Q86VY4.pdb.gz	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
8	AFDB:Q7JMA9	0.577	0.536	5.747E-20	313	0.352	0.326	Q7JMA9.pdb.gz	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
9	AFDB:Q6FI91	0.573	0.392	4.344E-19	438	0.283	0.187	Q6FI91.pdb.gz	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
10	AFDB:Q9UJ04	0.546	0.393	1.891E-18	414	0.279	0.196	Q9UJ04.pdb.gz	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
11	PDB:7c7xE	0.540	0.879	1.163E-16	174	0.279	0.466	7c7xE.pdb.gz
12	PDB:5gpkB	0.471	0.639	4.687E-12	207	0.169	0.237	5gpkB.pdb.gz
13	PDB:3fs3A	0.535	0.772	6.770E-12	197	0.210	0.310	3fs3A.pdb.gz
14	PDB:6k09A	0.499	0.537	8.884E-11	267	0.200	0.217	6k09A.pdb.gz
15	PDB:7un6B	0.502	0.594	5.587E-10	240	0.203	0.246	7un6B.pdb.gz
16	PDB:6n2gA	0.519	0.527	1.904E-9	285	0.200	0.204	6n2gA.pdb.gz
17	PDB:2ayuA	0.488	0.499	2.288E-9	283	0.210	0.216	2ayuA.pdb.gz
18	PDB:3q66A	0.481	0.577	2.586E-9	236	0.169	0.208	3q66A.pdb.gz
19	PDB:6baqF	0.126	0.160	4.346E-1	211	0.052	0.071	6baqF.pdb.gz
20	PDB:6pyuA	0.108	0.039	4.346E-1	930	0.041	0.013	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q01105	0.0	578	290	1.000	1.000	SET_HUMAN Protein SET OS=Homo sapiens OX=9606 GN=SET PE=1 SV=3
2	Q5VXV3	0.0	578	290	1.000	1.000	Q5VXV3_HUMAN SET OS=Homo sapiens OX=9606 GN=SET PE=2 SV=1
3	P0DME0	5.91e-166	464	302	0.786	0.755	SETLP_HUMAN Protein SETSIP OS=Homo sapiens OX=9606 GN=SETSIP PE=1 SV=1
4	Q9EQU5	5.61e-160	448	289	0.769	0.772	SET_MOUSE Protein SET OS=Mus musculus OX=10090 GN=Set PE=1 SV=1
5	Q63945	1.01e-159	447	289	0.769	0.772	SET_RAT Protein SET OS=Rattus norvegicus OX=10116 GN=Set PE=2 SV=2
6	Q6TGU0	1.98e-144	408	275	0.683	0.720	Q6TGU0_DANRE Myeloid leukemia-associated SET translocation protein OS=Danio rerio OX=7955 GN=SET PE=1 SV=1
7	Q8LC68	9.78e-54	177	255	0.300	0.341	NRP2_ARATH NAP1-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=NRP2 PE=1 SV=2
8	Q86VY4	6.94e-50	172	417	0.293	0.204	TSYL5_HUMAN Testis-specific Y-encoded-like protein 5 OS=Homo sapiens OX=9606 GN=TSPYL5 PE=1 SV=2
9	Q9H0U9	2.65e-49	171	437	0.255	0.169	TSYL1_HUMAN Testis-specific Y-encoded-like protein 1 OS=Homo sapiens OX=9606 GN=TSPYL1 PE=1 SV=3
10	Q6FI91	3.76e-49	170	438	0.255	0.169	Q6FI91_HUMAN TSPYL protein OS=Homo sapiens OX=9606 GN=TSPYL PE=1 SV=1
11	Q18240	9.59e-49	166	312	0.328	0.304	SPR2_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=2 SV=2
12	Q7JMA9	2.06e-48	165	313	0.324	0.300	Q7JMA9_CAEEL Suppressor of presenilin-2 OS=Caenorhabditis elegans OX=6239 GN=spr-2 PE=1 SV=1
13	Q9UJ04	6.54e-48	166	414	0.259	0.181	TSYL4_HUMAN Testis-specific Y-encoded-like protein 4 OS=Homo sapiens OX=9606 GN=TSPYL4 PE=1 SV=2
14	Q9H2G4	1.14e-47	171	693	0.259	0.108	TSYL2_HUMAN Testis-specific Y-encoded-like protein 2 OS=Homo sapiens OX=9606 GN=TSPYL2 PE=1 SV=1
15	Q9CA59	7.59e-47	159	256	0.321	0.363	NRP1_ARATH NAP1-related protein 1 OS=Arabidopsis thaliana OX=3702 GN=NRP1 PE=1 SV=1
16	Q8N831	1.08e-45	160	410	0.248	0.176	TSYL6_HUMAN Testis-specific Y-encoded-like protein 6 OS=Homo sapiens OX=9606 GN=TSPYL6 PE=1 SV=1
17	A6NKD2	1.00e-42	150	308	0.252	0.237	TSPY2_HUMAN Testis-specific Y-encoded protein 2 OS=Homo sapiens OX=9606 GN=TSPY2 PE=1 SV=1
18	P0CW01	1.45e-42	150	308	0.252	0.237	TSPYA_HUMAN Testis-specific Y-encoded protein 10 OS=Homo sapiens OX=9606 GN=TSPY10 PE=1 SV=2
19	Q01534	8.04e-42	148	308	0.252	0.237	TSPY1_HUMAN Testis-specific Y-encoded protein 1 OS=Homo sapiens OX=9606 GN=TSPY1 PE=1 SV=4
20	Q9R1M3	4.42e-37	136	334	0.203	0.177	TSPY1_RAT Testis-specific Y-encoded protein 1 OS=Rattus norvegicus OX=10116 GN=Tspy1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11629 Mst1_SARAH	80	14.6	C terminal SARAH domain of Mst1
2	PF00956 NAP	1.4e-33	127.8	Nucleosome assembly protein (NAP)
3	PF07352 Phage_Mu_Gam	11	17.4	Bacteriophage Mu Gam like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361777

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417864	0.997	Acidic leucine-rich nuclear phosphoprotein 32 family member A
2	9606.ENSP00000216714	0.987	DNA-(apurinic or apyrimidinic site) lyase
3	9606.ENSP00000337060	0.987	Nucleoside diphosphate kinase A
4	9606.ENSP00000274306	0.986	Granzyme A
5	9606.ENSP00000296503	0.969	High mobility group protein B2
6	9606.ENSP00000405330	0.946	Estrogen receptor
7	9606.ENSP00000418447	0.944	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
8	9606.ENSP00000377036	0.912	Serine/threonine-protein phosphatase 2A activator
9	9606.ENSP00000352400	0.911	Nuclear pore complex protein Nup214
10	9606.ENSP00000384863	0.893	Exportin-1
11	9606.ENSP00000385269	0.883	ELAV-like protein 1
12	9606.ENSP00000215742	0.861	THAP domain-containing protein 7
13	9606.ENSP00000342924	0.834	Microcephalin
14	9606.ENSP00000231509	0.801	Glucocorticoid receptor
15	9606.ENSP00000343505	0.800	Tumor necrosis factor ligand superfamily member 13
16	9606.ENSP00000229239	0.798	Glyceraldehyde-3-phosphate dehydrogenase
17	9606.ENSP00000310275	0.774	Barrier-to-autointegration factor
18	9606.ENSP00000476960	0.772	Histone cluster 2 H3 pseudogene 2
19	9606.ENSP00000296417	0.771	Histone H2A.Z
20	9606.ENSP00000344547	0.765	Prothymosin alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042393	0.460	histone binding
GO:0042802	0.428	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0050794	0.953	regulation of cellular process
GO:0071704	0.912	organic substance metabolic process
GO:0044238	0.911	primary metabolic process
GO:0006807	0.870	nitrogen compound metabolic process
GO:0043170	0.826	macromolecule metabolic process
GO:0009889	0.808	regulation of biosynthetic process
GO:0044237	0.805	cellular metabolic process
GO:0031323	0.788	regulation of cellular metabolic process
GO:0010468	0.754	regulation of gene expression
GO:0006355	0.742	regulation of DNA-templated transcription
GO:0071840	0.714	cellular component organization or biogenesis
GO:0016043	0.668	cellular component organization
GO:0048519	0.648	negative regulation of biological process
GO:0048518	0.645	positive regulation of biological process
GO:0051246	0.625	regulation of protein metabolic process
GO:0009892	0.556	negative regulation of metabolic process
GO:0010605	0.553	negative regulation of macromolecule metabolic process
GO:0048523	0.528	negative regulation of cellular process
GO:0031399	0.522	regulation of protein modification process
GO:0034641	0.501	cellular nitrogen compound metabolic process
GO:0048522	0.500	positive regulation of cellular process
GO:0006139	0.478	nucleobase-containing compound metabolic process
GO:0090304	0.474	nucleic acid metabolic process
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0051173	0.449	positive regulation of nitrogen compound metabolic process
GO:0031325	0.447	positive regulation of cellular metabolic process
GO:1901983	0.429	regulation of protein acetylation
GO:0032502	0.356	developmental process
GO:0048856	0.354	anatomical structure development
GO:0051172	0.343	negative regulation of nitrogen compound metabolic process
GO:0050896	0.338	response to stimulus
GO:0044085	0.319	cellular component biogenesis
GO:0031324	0.305	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.971	cytoplasm
GO:0032991	0.947	protein-containing complex
GO:0005811	0.937	lipid droplet
GO:0005829	0.360	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]